DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56i and Obp57d

DIOPT Version :10

Sequence 1:NP_725929.1 Gene:Obp56i / 246667 FlyBaseID:FBgn0043532 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_725973.1 Gene:Obp57d / 246671 FlyBaseID:FBgn0043536 Length:136 Species:Drosophila melanogaster


Alignment Length:104 Identity:26/104 - (25%)
Similarity:40/104 - (38%) Gaps:18/104 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DQCMAAAGITAQDVANRHETDDPGH--------SVKCFFRCFLENIGII-ADNQI-IPGAFDR-V 81
            |.|....||. :|:|.....|.|.:        |.||:..|.|:...|: |..:| :...:|. |
  Fly    31 DPCPHNQGID-EDIAESILGDWPANVDLTSVKRSHKCYVTCILQYYNIVTASGEIFLDKYYDTGV 94

  Fly    82 LGHIVTAEAVERMEATCNMIKSETSHDESCEFAWQISEC 120
            :..:..|..:.|......|   ||.:   |...:.|..|
  Fly    95 IDELAVAPKINRCRYEFRM---ETDY---CSRIFAIFNC 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56iNP_725929.1 PBP_GOBP 25..121 CDD:460193 26/104 (25%)
Obp57dNP_725973.1 PBP_GOBP 43..132 CDD:472229 21/91 (23%)

Return to query results.
Submit another query.