DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56i and LOC1277700

DIOPT Version :10

Sequence 1:NP_725929.1 Gene:Obp56i / 246667 FlyBaseID:FBgn0043532 Length:140 Species:Drosophila melanogaster
Sequence 2:XP_317184.2 Gene:LOC1277700 / 1277700 VectorBaseID:AGAMI1_010274 Length:168 Species:Anopheles gambiae


Alignment Length:130 Identity:29/130 - (22%)
Similarity:49/130 - (37%) Gaps:27/130 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLVVVTLPTCFVQAGPIK-----DQCMAAAGITAQD--VANRHETDDPGHSVKCFFRCFLENIGI 67
            ||:.|.|..|.:..|..:     ::|....|.:.:|  ...|..|......:....:|.||.:|.
Mosquito     5 LLLSVGLVWCLISLGQARKESTVEECEKNIGDSLKDRVCELRQYTPVSSDDMDKHMQCVLEVVGF 69

  Fly    68 IADNQIIPGAFDRVLGHI---VTAEAVERMEA----TCNMIK--SETSHDESCEFAWQISECYEG 123
            :..|           |.:   |..|.::|:::    ..||.|  :|.|...|.:.|.....|:.|
Mosquito    70 VDGN-----------GEVKESVLLELLQRVDSGVNHAANMKKCVTEASTSGSDKKANTFYTCFLG 123

  Fly   124  123
            Mosquito   124  123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56iNP_725929.1 PBP_GOBP 25..121 CDD:460193 21/111 (19%)
LOC1277700XP_317184.2 PhBP 26..122 CDD:214783 22/106 (21%)

Return to query results.
Submit another query.