DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG46385 and tent5ab

Sequence 1:NP_001356959.1 Gene:CG46385 FlyBaseID:FBgn0286778 Length:1107 Species:Drosophila melanogaster
Sequence 2:NP_001096595.1 Gene:tent5ab ZFINID:ZDB-GENE-071004-35 Length:389 Species:Danio rerio

Alignment Length:340 Identity:203/341 (60%)
Similarity:250/341 (73%) Gaps:14/341 (4%)


  Fly   397 LAVLSFEQVSKLHDVMDEKVAIHGRGNFPTLEVKLKDLVNLVRRKLEAEVNAGGAGVLVKDIRLN 461
            |.||::|||.:|..::.|.:.|||:.||||||:|.:|:|.:||.::|..      .:.|:::|||
Zfish     8 LCVLNWEQVKRLDAILTESIPIHGKWNFPTLEMKPRDIVKVVRCRMEER------KIHVREVRLN 66

  Fly   462 GGAASHVLASEDQ--PYNDLDLIFAIELSSPRVFDRVKVAVLNTLLDLMPEGVCKRRIYTCSLKE 524
            |.|||||| .||.  .|.||||||..:|.....|..||..||::|||.:||||.|.:|...:|||
Zfish    67 GSAASHVL-HEDSGLGYKDLDLIFCADLKGEVEFQTVKDIVLDSLLDFLPEGVNKEKITPVTLKE 130

  Fly   525 AYVGKMVKVNNNNDGDRWSLISLGNSPGHKNVELKFVDTMRRQFEFSVDSFQIVLDSLLLFYDCA 589
            |||.|||||  .||.||||||||.|:.| |||||||||::|||||||||||||.||||||||:|:
Zfish   131 AYVQKMVKV--CNDSDRWSLISLSNNSG-KNVELKFVDSLRRQFEFSVDSFQIRLDSLLLFYECS 192

  Fly   590 ALPISENFYPTVVGESVYGDFQEALYHLQKKLISTRQPEEIRGGGLLKYCNLLVRNYKAVDSQLI 654
            ..|::|.|:|::|||||||||..||.|||:|||.||.|||||||||||||:||||.::|.....:
Zfish   193 ENPMAETFHPSIVGESVYGDFSVALDHLQRKLICTRNPEEIRGGGLLKYCHLLVRGFRAASEAEM 257

  Fly   655 KTLERYMCSRFFIDFPDINTQTTKLEAYLRNHFWGVDEEPLQYQYLMHLREVVEMSTVCLMGHER 719
            |.|||||||||||||.|:..|..|||:||:|||.|::..  :|:||..|..||..||||||||||
Zfish   258 KLLERYMCSRFFIDFSDVAEQRRKLESYLQNHFVGLENR--KYEYLTTLHSVVNESTVCLMGHER 320

  Fly   720 RQSLHLIQSLAAQVL 734
            ||:|.||..||.:||
Zfish   321 RQTLSLITMLAVRVL 335

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG46385NP_001356959.1 None
tent5abNP_001096595.1 NTP_transf_7 11..329 CDD:285258 197/330 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C119005877
eggNOG 1 0.900 E1_KOG3852
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000503
OrthoInspector 1 1.000 T595897
orthoMCL 1 0.900 OOG5_130361
Panther 1 1.100 O PTHR12974
Phylome 1 0.910 0.889 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.710

Return to query results.
Submit another query.