DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG46385 and tent5aa

Sequence 1:NP_001356959.1 Gene:CG46385 FlyBaseID:FBgn0286778 Length:1107 Species:Drosophila melanogaster
Sequence 2:XP_005157917.1 Gene:tent5aa ZFINID:ZDB-GENE-140106-27 Length:393 Species:Danio rerio

Alignment Length:347 Identity:201/348 (58%)
Similarity:253/348 (73%) Gaps:13/348 (4%)


  Fly   390 DTGG-TQRLAVLSFEQVSKLHDVMDEKVAIHGRGNFPTLEVKLKDLVNLVRRKLEAEVNAGGAGV 453
            |.|. :...:|||:|||.:|..::.|.:.||||||||||::|.:.:|..|||::..:      .:
Zfish     5 DAGAESSNFSVLSWEQVQRLDLILTETIPIHGRGNFPTLQMKPRQIVTAVRRRMREK------SI 63

  Fly   454 LVKDIRLNGGAASHVLASED-QPYNDLDLIFAIELSSPRVFDRVKVAVLNTLLDLMPEGVCKRRI 517
            .|:|:||||.||||||..:. ..|.||||||.:||.....|..||..||:.|||.:|:||.|.:|
Zfish    64 HVRDVRLNGSAASHVLHGDSGLGYKDLDLIFRVELKGETEFQIVKNIVLDCLLDFLPDGVNKEKI 128

  Fly   518 YTCSLKEAYVGKMVKVNNNNDGDRWSLISLGNSPGHKNVELKFVDTMRRQFEFSVDSFQIVLDSL 582
            ...:||||||.|||||  .||.||||||||.|:.| |||||||||::|||||||||||||.||||
Zfish   129 TPLTLKEAYVQKMVKV--CNDSDRWSLISLSNNRG-KNVELKFVDSLRRQFEFSVDSFQIKLDSL 190

  Fly   583 LLFYDCAALPISENFYPTVVGESVYGDFQEALYHLQKKLISTRQPEEIRGGGLLKYCNLLVRNYK 647
            ||||:|:..|:::.|:||::||||||||..||.||:.|:|.||.|||||||||||||:||||.::
Zfish   191 LLFYECSENPMAKTFHPTIIGESVYGDFAAALDHLRNKIICTRNPEEIRGGGLLKYCHLLVRGFR 255

  Fly   648 AVDSQLIKTLERYMCSRFFIDFPDINTQTTKLEAYLRNHFWGVDEEPLQYQYLMHLREVVEMSTV 712
            |.....:|:|:|||||||||||.||:.|..|||:||:|||.|:::.  :|.||..|..||..|||
Zfish   256 AASESEMKSLQRYMCSRFFIDFSDISEQQRKLESYLQNHFVGLEDR--KYDYLTTLHSVVNESTV 318

  Fly   713 CLMGHERRQSLHLIQSLAAQVL 734
            |||||||||:|.||..||.:||
Zfish   319 CLMGHERRQTLGLIAMLAVRVL 340

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG46385NP_001356959.1 None
tent5aaXP_005157917.1 NTP_transf_7 16..334 CDD:285258 194/329 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C119005869
eggNOG 1 0.900 E1_KOG3852
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000503
OrthoInspector 1 1.000 T595897
orthoMCL 1 0.900 OOG5_130361
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.889 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
76.600

Return to query results.
Submit another query.