DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30480 and Abd-B

DIOPT Version :9

Sequence 1:NP_001260976.1 Gene:CG30480 / 246640 FlyBaseID:FBgn0050480 Length:920 Species:Drosophila melanogaster
Sequence 2:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster


Alignment Length:270 Identity:59/270 - (21%)
Similarity:90/270 - (33%) Gaps:75/270 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 HRHHH---------HHHRHHHH----HERQENVEVVATEEVILVENAPKSRKHHH----HKQRTS 89
            |.|||         |||..|.|    .::|::..|.::...:|.:...:|....|    |.....
  Fly    34 HAHHHLPQPLHTTSHHHSAHPHLQQQQQQQQHAVVASSPSSVLQQQQQQSTPTTHSTPTHAVMYE 98

  Fly    90 PPPPLPQTSPPFLTPTEEVGFNVVWEPQAFWNQPSPNPSTDLDLSQDNEVVDAVETMDTTSASDE 154
            .|||:|..                    |...|..|.|.....|.|..:  ...:.:.||..:..
  Fly    99 DPPPVPLV--------------------AVQQQHLPAPQQQQQLQQQQQ--QQQQQLATTPVAGA 141

  Fly   155 FTTVVFQSETKESIRETQKHTRVVEEEIIIDQLDPPPYAPPPLQVQTGFFPVAQQPPLSPIAEVV 219
            .:..  |:.|..|.::.|..|....:::        |....|..|.:|.....||......|.|.
  Fly   142 LSPA--QTPTGPSAQQQQHLTSPHHQQL--------PQQQTPNSVASGASSNLQQQQQQQNAAVA 196

  Fly   220 --QTDVVAESVEPPLPPTGYIPRINLKPTETIVENVEVIVPAQIQQEPEFIPQ----PGFVARIV 278
              ||.:||       |.|.     ::.|:.  |.:.:..:...||..|..||.    |||     
  Fly   197 PGQTQIVA-------PTTA-----SVSPSS--VSSQKEDINMSIQLAPLHIPAIRAGPGF----- 242

  Fly   279 ENIEVAAASK 288
             ..:.:||.|
  Fly   243 -ETDTSAAVK 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30480NP_001260976.1 PRK10263 <499..>757 CDD:236669
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439754
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.