DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30480 and ftz

Sequence 1:NP_001260976.1 Gene:CG30480 FlyBaseID:FBgn0050480 Length:920 Species:Drosophila melanogaster
Sequence 2:NP_477498.1 Gene:ftz FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster

Alignment Length:275 Identity:49/276 (18%)
Similarity:91/276 (33%) Gaps:83/276 (30%)


  Fly   539 SVVERLDVTEEVEPSVRPPLPLSYPPRSGFVESIVENIEVEQVTPSYQPPQQIVPQSGFVET--- 600
            |..:.:::.....|...||   :|...||       :....|.|.:|   |...||..:.|:   
  Fly    11 SYADNMNMYNMYHPHSLPP---TYYDNSG-------SNAYYQNTSNY---QGYYPQESYSESCYY 62

  Fly   601 FVEDIEIKESALPPIQNGYAP-----------QAGVVETIVEEVE----IVPDPPRQSIVTTDYM 650
            :....::....:||:|....|           .|.::..:.|...    ::.:|.::...|.||.
  Fly    63 YNNQEQVTTQTVPPVQPTTPPPKATKRKAEDDAASIIAAVEERPSTLRALLTNPVKKLKYTPDYF 127

  Fly   651 PRASLVQELVVESLEVTP------TSSPPP---EQFPFISRESLIVADDYVEVEEVTPYNTAPHS 706
                   ...||.::..|      |:||.|   :::..:...|.....||::|          :|
  Fly   128 -------YTTVEQVKKAPAVSTKVTASPAPSYDQEYVTVPTPSASEDVDYLDV----------YS 175

  Fly   707 PIVEVERLSEAESYVEINEVAPVNTPPQRSVEVGFLPRPSLAETAVVVESVEVTPTPTPPPSPAL 771
            |..:.::|...: :.......|.:.||...:.                         |||.||..
  Fly   176 PQSQTQKLKNGD-FATPPPTTPTSLPPLEGIS-------------------------TPPQSPGE 214

  Fly   772 KLKIPPSNQIPSEVI 786
            |.....|.:|...::
  Fly   215 KSSSAVSQEINHRIV 229

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30480NP_001260976.1 PRK10263 <499..>757 CDD:236669 41/245 (17%)
ftzNP_477498.1 FTZ 1..248 CDD:281812 49/276 (18%)
Homeobox 257..310 CDD:278475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C129371692
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.