DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30480 and Scr

Sequence 1:NP_001260976.1 Gene:CG30480 FlyBaseID:FBgn0050480 Length:920 Species:Drosophila melanogaster
Sequence 2:NP_001356915.1 Gene:Scr FlyBaseID:FBgn0003339 Length:508 Species:Drosophila melanogaster

Alignment Length:116 Identity:24/117 (21%)
Similarity:46/117 (39%) Gaps:16/117 (14%)


  Fly   673 PPEQFPFISR----ESLIVADDYVEVEEV--TPYNTAPHSPIVEVERLSEAESYVEIN---EVAP 728
            ||:.:|::.|    .|.:.|:...:.:..  |.|.|      :|:|:......|:...   |:|.
  Fly   301 PPQIYPWMKRVHLGTSTVNANGETKRQRTSYTRYQT------LELEKEFHFNRYLTRRRRIEIAH 359

  Fly   729 VNTPPQRSVEVGFLPRPSLAETAVVVESVEVTPTPTPP-PSPALKLKIPPS 778
            .....:|.:::.|..|....:....:.|:.:.|....| ..|..:..|.||
  Fly   360 ALCLTERQIKIWFQNRRMKWKKEHKMASMNIVPYHMGPYGHPYHQFDIHPS 410

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30480NP_001260976.1 PRK10263 <499..>757 CDD:236669 18/93 (19%)
ScrNP_001356915.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C129371093
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.