DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30480 and bcd

Sequence 1:NP_001260976.1 Gene:CG30480 FlyBaseID:FBgn0050480 Length:920 Species:Drosophila melanogaster
Sequence 2:NP_788587.1 Gene:bcd FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster

Alignment Length:456 Identity:92/457 (20%)
Similarity:129/457 (28%) Gaps:175/457 (38%)


  Fly    44 HHH---HHHRHHHHHERQENVEVVATEEVILVENAPKSRKHHHHKQRTSPPPPLPQTSPPFLTP- 104
            :||   |.|.|.|.|....                |.|..|.||:.      |..|..|.|..| 
  Fly    11 YHHPLPHTHTHPHPHSHPH----------------PHSHPHPHHQH------PQLQLPPQFRNPF 53

  Fly   105 -------TEEVGFNVVWEPQAFWNQPSPN--PSTDLDLSQDNEVVDAVETMDTTSASDEFTTVVF 160
                   |..:.:|.: .|......|.|:  ||.:|   .|:.|:.......||..|.:      
  Fly    54 DLLFDERTGAINYNYI-RPYLPNQMPKPDVFPSEEL---PDSLVMRRPRRTRTTFTSSQ------ 108

  Fly   161 QSETKESIRETQKH-------------------------------TRVVEEEIIIDQLDPPPYA- 193
                   |.|.::|                               .|....:|..||.....|. 
  Fly   109 -------IAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRHKIQSDQHKDQSYEG 166

  Fly   194 -------------PPPLQVQT---GFFPVAQQP---PLSPIAEVVQTDVVAESVEPPLP------ 233
                         ||.||..:   |..|.|..|   |.:|.|.:  |:..:||......      
  Fly   167 MPLSPGMKQSDGDPPSLQTLSLGGGATPNALTPSPTPSTPTAHM--TEHYSESFNAYYNYNGGHN 229

  Fly   234 ------------PTGYIPRINLKPTETIVENVEVI------------------VPAQIQQEPEFI 268
                        |:|..|    .|..|.|...:..                  ||.|:||:.:..
  Fly   230 HAQANRHMHMQYPSGGGP----GPGSTNVNGGQFFQQQQVHNHQQQLHHQGNHVPHQMQQQQQQA 290

  Fly   269 PQPGFVARIVENIEVAAASKSSLVSPQ------KSYYPRTGMVETIVEDIEVVKDDAPVQSGYIP 327
            .|..:.....:..:.:|........|:      .|||.|:||.........|.:..|.      |
  Fly   291 QQQQYHHFDFQQKQASACRVLVKDEPEADYNFNSSYYMRSGMSGATASASAVARGAAS------P 349

  Fly   328 GNVEVESIVENIDADSPFLL-----PPNGFATDESIVENIEVSTDVDDS-------PFLLPVNGF 380
            |:...|.:....| :||.|.     .|...|..|:     |.:.|:||.       ..|.|:.|.
  Fly   350 GSEVYEPLTPKND-ESPSLCGIGIGGPCAIAVGET-----EAADDMDDGTSKKTTLQILEPLKGL 408

  Fly   381 D 381
            |
  Fly   409 D 409

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30480NP_001260976.1 PRK10263 <499..>757 CDD:236669
bcdNP_788587.1 Homeobox 106..153 CDD:278475 5/60 (8%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C129372508
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.