DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30480 and zen

Sequence 1:NP_001260976.1 Gene:CG30480 FlyBaseID:FBgn0050480 Length:920 Species:Drosophila melanogaster
Sequence 2:NP_476793.1 Gene:zen FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster

Alignment Length:432 Identity:78/433 (18%)
Similarity:129/433 (30%) Gaps:133/433 (31%)


  Fly   327 PGNVEVESIVENIDAD-SPFLLPPNGFATDESIVENIEVSTDVDDSPFLLPVNGFDSEPVCVESI 390
            |..|:...::.....| :|..||||              ...::.:|..|  |...|.....:..
  Fly    22 PSEVKYSDLIYGHHHDVNPIGLPPN--------------YNQMNSNPTTL--NDHCSPQHVHQQH 70

  Fly   391 VENIEVTPSQPVLQISDQSVVPAGFVESAVEDIQVIETEDPPFLLPTENDFTAQAGNVESLIENI 455
            |.:.|..||||   ..|...|......:|...:|::|         .||:|.:......:  ..|
  Fly    71 VSSDENLPSQP---NHDSQRVKLKRSRTAFTSVQLVE---------LENEFKSNMYLYRT--RRI 121

  Fly   456 EVTTEVDLTLRQSEQIENLPRSGFVESIVENIEVTQEVDPPQPAVPSDVVTQSGLVESIVENIEV 520
            |:...:.|..||.:......|..|.:.|..:.|........||                      
  Fly   122 EIAQRLSLCERQVKIWFQNRRMKFKKDIQGHREPKSNAKLAQP---------------------- 164

  Fly   521 TEIVDIQAPAPPQTGFVESVVERLDVTEEVEPSVRPPLPLSYPPRSGFVESIVENIEVEQVT--- 582
                  ||......|    :|:||             :..|..||.|  .:..|...:..|.   
  Fly   165 ------QAEQSAHRG----IVKRL-------------MSYSQDPREG--TAAAEKRPMMAVAPVN 204

  Fly   583 --PSYQPPQQIVPQSGFVETFVEDIEIKESALPPIQNGYAPQAGVVETIVEEVEIVPDPPRQSIV 645
              |.||..|::..::.                  ..||....|.:.| |:|.:......|:.|..
  Fly   205 PKPDYQASQKMKTEAS------------------TNNGMCSSADLSE-ILEHLAQTTAAPQVSTA 250

  Fly   646 TTD---------------YMPRASLVQELVVESLEVTPTSSPPPEQFPFISRESLIVADDYVEVE 695
            |:.               |.....||.:.:.:.||....:....:..|.::.:|...:.   :.:
  Fly   251 TSSTGTSTNSASSSSSGHYSYNVDLVLQSIKQDLEAAAQAWSKSKSAPILATQSWHPSS---QSQ 312

  Fly   696 EVTPYNTAPH------SPIVEVERLSEAESYVEINEVAPVNT 731
            ..|..:.||.      .|..:..:||       :|.:.|..|
  Fly   313 VPTSVHAAPSMNLSWGEPAAKSRKLS-------VNHMNPCVT 347

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30480NP_001260976.1 PRK10263 <499..>757 CDD:236669 41/260 (16%)
zenNP_476793.1 Homeobox 93..146 CDD:278475 13/64 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C258227880
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.