DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30480 and pb

DIOPT Version :10

Sequence 1:NP_725409.1 Gene:CG30480 / 246640 FlyBaseID:FBgn0050480 Length:920 Species:Drosophila melanogaster
Sequence 2:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster


Alignment Length:224 Identity:35/224 - (15%)
Similarity:55/224 - (24%) Gaps:119/224 - (53%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DGSVAPKHRHHHHHHRHHH----HHER--------------------------QENVEVVATEEV 69
            :|:....|:..||||..||    ||:.                          |:..:....:.|
  Fly   554 NGTPYLNHQQQHHHHAQHHQQQQHHQNHVADFEGPVNGPSNFNNGAYYDNMSFQQQAQAHQHQTV 618

  Fly    70 ILVENAPK-----SRKHHHH-------------------------------KQRTSPPPPLPQT- 97
            :..:..|.     :.:|.||                               .......||:|.| 
  Fly   619 VFQQQQPHQPAAINHQHMHHLGNGETYSALGLQMENCEGYNNFGAAGTGGGYYEAGQQPPIPATH 683

  Fly    98 ----------------------------------SPPFLTPTEEVGFNVVWEP----QAFWNQPS 124
                                              .||   |:...||.:...|    |||.|..|
  Fly   684 GHGHHPHHVQVPAQAHAPIHAHHNSAAIPGGVGVGPP---PSHIHGFAINGGPAVQGQAFGNNGS 745

  Fly   125 PNPSTDLDLSQDNEVVDAVETMDTTSASD 153
            ....|           .|:..::.:::||
  Fly   746 TAAGT-----------AAISGLENSNSSD 763

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30480NP_725409.1 None
pbNP_476669.3 Homeodomain 199..255 CDD:459649
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.