DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30480 and lab

Sequence 1:NP_001260976.1 Gene:CG30480 FlyBaseID:FBgn0050480 Length:920 Species:Drosophila melanogaster
Sequence 2:NP_476613.1 Gene:lab FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster

Alignment Length:254 Identity:45/255 (18%)
Similarity:89/255 (35%) Gaps:43/255 (17%)


  Fly   640 PRQSIVTTDYMPRASLVQELVVESLEVTPTSSPPPEQFPFISRESLIVADDYVEVE-EVTPYNTA 703
            |:|      :.|...|.|:...:.|:      .|.:...:...||....:.|.:.: ::||..|:
  Fly    41 PQQ------HQPHLQLQQQQQHQHLQ------QPQQHLTYNGYESSSPGNYYPQQQAQLTPPPTS 93

  Fly   704 PHSPIVEVERLSEAESYVEINEVAPVNTPPQRSVEVGFLPRPSLAETAVVVESVEVTPTPTPPPS 768
            .|..:.:.::..:|:.              |:......|..||.||..:      .|.|.|..|.
  Fly    94 SHQVVQQHQQQQQAQQ--------------QQLYPHSHLFSPSAAEYGI------TTSTTTGNPG 138

  Fly   769 PALKLKIPPSNQIPSEVIVDQPVPSSTFKPP-----AKPLNNFILTDLVIDDPPFVEVVEREVVV 828
            ..|.    ||:..|::...:.....|.:...     |.|.|:..:|..........:..:::..:
  Fly   139 TPLH----PSSHSPADSYYESDSVHSYYATAAVATVAPPSNSSPITAANASATSNTQQQQQQAAI 199

  Fly   829 ESANNGQVTEVIEVTEEIIQPVTPIGTVLVGEVSEQNSDKFGKRYSLSATLADGQQQVQ 887
            .|:.||.:...::......|...|:.. ..|::.|:.:......|:....|.|....:|
  Fly   200 ISSENGMMYTNLDCMYPTAQAQAPVHG-YAGQIEEKYAAVLHASYAPGMVLEDQDPMMQ 257

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30480NP_001260976.1 PRK10263 <499..>757 CDD:236669 21/118 (18%)
labNP_476613.1 Homeobox 505..557 CDD:278475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C129372284
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.