DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30480 and ind

DIOPT Version :10

Sequence 1:NP_725409.1 Gene:CG30480 / 246640 FlyBaseID:FBgn0050480 Length:920 Species:Drosophila melanogaster
Sequence 2:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster


Alignment Length:73 Identity:13/73 - (17%)
Similarity:31/73 - (42%) Gaps:10/73 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 QIITNYCLLAIVIVYSYQSLIISYLTYTRYSPEINTMDEIRNNCIFPSGSSWAAYFDFH--TDGE 405
            :::::.|.:.|   |.:..:.:.:..:.|..|.:.....:.....:..|:     .|.|  .|.|
  Fly     9 RVLSSNCSIRI---YFHSQVSLPHNQFKRLPPVVAFKFVLPPEIFYGGGT-----IDEHIGDDTE 65

  Fly   406 YDDERDNM 413
            .::|||.:
  Fly    66 EEEERDEL 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30480NP_725409.1 None
indNP_996087.2 Homeodomain 228..284 CDD:459649
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.