DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30480 and ind

DIOPT Version :9

Sequence 1:NP_001260976.1 Gene:CG30480 / 246640 FlyBaseID:FBgn0050480 Length:920 Species:Drosophila melanogaster
Sequence 2:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster


Alignment Length:224 Identity:44/224 - (19%)
Similarity:74/224 - (33%) Gaps:71/224 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 VENAPKSRKHHH-----HKQRTS---------PPPPL-----PQTSPPF--LTPTEEVGFNVVWE 115
            |.::|.|..|.:     .|:::|         |.|||     .|..||.  |..:..||...:.|
  Fly    98 VSSSPGSLYHPYAQLFASKRKSSGFSNYEGCYPSPPLSANPNSQQLPPIHNLYGSPVVGGLPLPE 162

  Fly   116 PQAFWNQPSPNPSTDLDLSQD-------------------------------------NEVVDAV 143
            |.:|...||.:.|..||.:.:                                     |:..|:.
  Fly   163 PGSFCTSPSASSSASLDYTNNFDEPQGKRFKHESSCSPNSSPLKNHSSGGPVEITPLINDYADSS 227

  Fly   144 ETMDTTSASD-------EFTTVVFQS-----ETKESIRETQKHTRVVEEEIIIDQLDPPPYAPPP 196
            :.:.|...|.       ||:...:.|     |....:|.::|..::..:...:.|......: |.
  Fly   228 KRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRVKQKKGGSES-PT 291

  Fly   197 LQVQTGFFPVAQQPPLSPIAEVVQTDVVA 225
            ..:.|......|..|:||..:|.:..|.|
  Fly   292 FNLSTNSNGSPQASPVSPQVKVHELKVEA 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30480NP_001260976.1 PRK10263 <499..>757 CDD:236669
indNP_996087.2 Homeobox 231..283 CDD:278475 8/51 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460739
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.