DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30424 and CTR9

Sequence 1:NP_001097455.1 Gene:CG30424 FlyBaseID:FBgn0050424 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_055448.1 Gene:CTR9 HGNCID:16850 Length:1173 Species:Homo sapiens

Alignment Length:394 Identity:82/395 (21%)
Similarity:138/395 (35%) Gaps:136/395 (34%)


  Fly    20 YYKSIAVTRDPKIPGNVLLDMTRVLELLK--DDPREDFQRIREL-------IQGRLVDAQNFFVV 75
            |||. |:..:|..|..|.|.|......|.  :..|..|.|..||       :.|..|...|....
Human   185 YYKK-ALRTNPGCPAEVRLGMGHCFVKLNKLEKARLAFSRALELNSKCVGALVGLAVLELNNKEA 248

  Fly    76 DRLRSWLQSLFSQA----------LNRIS---------YRVELVAGVVSH------LKYRTCGP- 114
            |.:::.:| |.|:|          ||.::         .:|:.:|....|      ::..:|.. 
Human   249 DSIKNGVQ-LLSRAYTIDPSNPMVLNHLANHFFFKKDYSKVQHLALHAFHNTEVEAMQAESCYQL 312

  Fly   115 AHTIYVYGDYEYSVD-YVPAICLAAEQNVLPTKQL--------------ECFKRANTSY---WEA 161
            |.:.:|..||:.:.. |..|...|:...|||...|              :||::...:|   :|.
Human   313 ARSFHVQEDYDQAFQYYYQATQFASSSFVLPFFGLGQMYIYRGDKENASQCFEKVLKAYPNNYET 377

  Fly   162 ------------------IPK-PLKPLTE------------------TSMISFRSSFYAVEKILL 189
                              |.| .||.:||                  |.:....|::....:||.
Human   378 MKILGSLYAASEDQEKRDIAKGHLKKVTEQYPDDVEAWIELAQILEQTDIQGALSAYGTATRILQ 442

  Fly   190 QDVHE-------NCRNAIRFMKKFRDVKTNLGNCKSYYIKTLFLWKIIQEPESYWLNPL----SF 243
            :.|..       |...|:.|.      ..|||..|.|::.:|...|...|.:.::.|.:    |:
Human   443 EKVQADVPPEILNNVGALHFR------LGNLGEAKKYFLASLDRAKAEAEHDEHYYNAISVTTSY 501

  Fly   244 ILADMFDDL-----AENLRRGVITFFWDPELNMIDALTRDQVWEMYLCVQRIPRDLRGAEISRNK 303
            .||.:::.:     ||.|.:.::.    ...|.:|            |..|:     || ::|:|
Human   502 NLARLYEAMCEFHEAEKLYKNILR----EHPNYVD------------CYLRL-----GA-MARDK 544

  Fly   304 WSFF 307
            .:|:
Human   545 GNFY 548

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30424NP_001097455.1 Mab-21 1..289 CDD:281298 76/375 (20%)
CTR9NP_055448.1 TPR 1 41..75
TPR 2 129..162
TPR repeat 131..157 CDD:276809
TPR 3 163..196 5/12 (42%)
TPR_11 165..228 CDD:290150 15/44 (34%)
TPR repeat 165..191 CDD:276809 4/7 (57%)
TPR repeat 196..227 CDD:276809 9/31 (29%)
TPR_11 198..266 CDD:290150 17/69 (25%)
TPR 4 198..231 9/33 (27%)
TPR 5 235..268 8/34 (24%)
TPR repeat 269..297 CDD:276809 4/28 (14%)
TPR 6 306..339 8/33 (24%)
TPR repeat 306..334 CDD:276809 7/28 (25%)
tol_pal_ybgF 310..420 CDD:188247 21/110 (19%)
TPR repeat 340..370 CDD:276809 6/30 (20%)
TPR 7 341..374 7/33 (21%)
TPR repeat 375..406 CDD:276809 6/31 (19%)
TPR 8 412..444 4/32 (13%)
TPR repeat 412..437 CDD:276809 2/25 (8%)
TPR repeat 444..487 CDD:276809 12/49 (24%)
TPR 9 451..484 10/39 (26%)
TPR_12 453..521 CDD:290160 18/74 (24%)
TPR 10 497..530 7/37 (19%)
TPR_12 498..563 CDD:290160 15/74 (20%)
TPR repeat 501..525 CDD:276809 5/24 (21%)
TPR repeat 530..560 CDD:276809 8/38 (21%)
TPR 11 531..564 8/37 (22%)
TPR repeat 565..593 CDD:276809
TPR 12 566..598
TPR 13 613..646
TPR_11 646..709 CDD:290150
TPR 14 647..680
TPR repeat 648..675 CDD:276809
TPR repeat 680..712 CDD:276809
TPR 15 681..714
TPR 16 717..750
TPR repeat 717..743 CDD:276809
PHA03249 1034..>1173 CDD:223023
SEEEED 1041..1154 CDD:291463
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D331478at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.