DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30424 and ITPRIP

Sequence 1:NP_001097455.1 Gene:CG30424 FlyBaseID:FBgn0050424 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_005270314.1 Gene:ITPRIP HGNCID:29370 Length:552 Species:Homo sapiens

Alignment Length:207 Identity:37/208 (18%)
Similarity:72/208 (35%) Gaps:56/208 (27%)


  Fly    61 LIQGR------------LVDAQNFFVVDRLR--SWLQSLFSQALNRIS--YRVELVAGVVS---- 105
            |:.||            |:.|.:...:|.::  .|.|:..::|...|:  |..:|..|.:.    
Human   274 LLHGRNSMAPPCGDMENLLCATDSLYLDTMQVMKWFQTALTRAWKGIAHKYEFDLAFGQLDSPGS 338

  Fly   106 -HLKYRTCGPAHTIYVYGDYEYSVDYVPAICLAAEQNVLPTKQLECFKRANTSYWEAIPKPLKPL 169
             .:|:|                |..::|.       |::|..|.:   .::..:...:|:.....
Human   339 LKIKFR----------------SGKFMPF-------NLIPVIQCD---DSDLYFVSHLPREPSEG 377

  Fly   170 TETSMISFRSSFYAVEKILLQDV---------HENCRNAIRFMKKFRDVKTNLGNCKSYYIKTLF 225
            |..|...:..||...|:..|:..         |.:|.....|:...:...|......||::||..
Human   378 TPASSTDWLLSFAVYERHFLRTTLKALPEGACHLSCLQIASFLLSKQSRLTGPSGLSSYHLKTAL 442

  Fly   226 LWKIIQEPESYW 237
            |..::....:.|
Human   443 LHLLLLRQAADW 454

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30424NP_001097455.1 Mab-21 1..289 CDD:281298 37/208 (18%)
ITPRIPXP_005270314.1 DivIC 17..>78 CDD:299713
Selenoprotein_S <48..>117 CDD:284376
Mab-21 <356..484 CDD:281298 18/103 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C54839854
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10656
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.