DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30424 and mab21l1

Sequence 1:NP_001097455.1 Gene:CG30424 FlyBaseID:FBgn0050424 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001072797.1 Gene:mab21l1 XenbaseID:XB-GENE-1001177 Length:359 Species:Xenopus tropicalis

Alignment Length:279 Identity:56/280 (20%)
Similarity:96/280 (34%) Gaps:96/280 (34%)


  Fly     2 LKIAKPNEFDLVFKLKFPYYKSIAV---TRDPKIPGNVLLDMTRVLELLKDDPREDFQRIRELIQ 63
            |::..|.||::|.     |...:.|   ..|..:||..:|.::            |.::....:.
 Frog    66 LEVISPTEFEVVL-----YLNQMGVFNFVDDGSLPGCAVLKLS------------DGRKRSMSLW 113

  Fly    64 GRLVDAQNFFVVDRLRSWLQSLFSQALNRISYR--VELVAGVVSHLKYRTCGPAHTIYVYGDYEY 126
            ...:.|..:....::||..|:|.:||:::.|||  |::||. .|.:|.|...           .|
 Frog   114 VEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVKMVAD-TSEVKLRIRD-----------RY 166

  Fly   127 SVDYVPAI-C----------------------------------LAAEQNVLPTKQLECFKRANT 156
            .|...||. |                                  |:.|.:.|..||    ..|.:
 Frog   167 VVQITPAFKCTGIWPRSAAHWPLPHIPWPGPNRVAEVKAEGFNLLSKECHTLAGKQ----SSAES 227

  Fly   157 SYWEAIPKPLKPLTETSMISFRSSFYAVEKILLQDVHENCRNAIRFMKKFRDVKTNLGN--CKSY 219
            ..|              ::.|..   |..::.|....:.|   :..:|..||....|..  ..:|
 Frog   228 DAW--------------VLQFAE---AENRLQLGGCRKKC---LSLLKTLRDRHLELPGQPLNNY 272

  Fly   220 YIKTLFLWKIIQEP-ESYW 237
            ::|||..::..:.| ||.|
 Frog   273 HMKTLVSYECEKHPRESDW 291

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30424NP_001097455.1 Mab-21 1..289 CDD:281298 56/280 (20%)
mab21l1NP_001072797.1 Mab-21 62..344 CDD:308741 56/280 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.