DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30424 and Itpripl1

Sequence 1:NP_001097455.1 Gene:CG30424 FlyBaseID:FBgn0050424 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_006500318.1 Gene:Itpripl1 MGIID:1920588 Length:599 Species:Mus musculus

Alignment Length:165 Identity:34/166 (20%)
Similarity:61/166 (37%) Gaps:40/166 (24%)


  Fly   171 ETSMISFRSSFYAVEKILLQDV---------HENCRNAIRFMKKF--------RDVKTNLGNCKS 218
            :.:.:.:..||.|.|.:.|:.|         |..|...:..::..        |.:.|      |
Mouse   432 QLTSVDWPESFAACEHLFLKLVGRFAPENTCHLKCLQIVLSLQDHQILPPGASRPILT------S 490

  Fly   219 YYIKTLFLWKIIQEPESYWLNP-LSFILADMFDDLAENLRRGVITFFWDPELNMIDALTRDQVWE 282
            |:.||..:..:::.|.:.|.:. ||..|.|:...|...|::..:..|              .:..
Mouse   491 YHFKTALMHLLLRLPLTDWQHSMLSLRLQDLLWFLGRGLQQRSLHHF--------------LIGN 541

  Fly   283 MYLCVQ-RIPRDLRGAEISRNKWSFFVLREFSHKK 316
            .||.:. .||:..|.|| ..|.:...||...:|.:
Mouse   542 TYLPLTIPIPKAFRNAE-PVNLFQHLVLNPVAHSQ 575

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30424NP_001097455.1 Mab-21 1..289 CDD:281298 25/137 (18%)
Itpripl1XP_006500318.1 Mab-21 <339..566 CDD:281298 31/155 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C54845656
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10656
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.