DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30424 and Cgas

Sequence 1:NP_001097455.1 Gene:CG30424 FlyBaseID:FBgn0050424 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_006243501.2 Gene:Cgas RGDID:1586939 Length:530 Species:Rattus norvegicus

Alignment Length:386 Identity:84/387 (22%)
Similarity:139/387 (36%) Gaps:137/387 (35%)


  Fly     2 LKIAKPNEFDLVFKLKFP------YYKSIAVTR--DPKIP-GNVL--------LDMTRVLELLKD 49
            :||:.|||||::|||:.|      ||::.|..|  ..:|| ||.|        |..|:||     
  Rat   207 VKISAPNEFDVMFKLEVPRIELEEYYETGAFYRVKFKRIPRGNPLSHFLEGEVLSATKVL----- 266

  Fly    50 DPREDFQRIRELIQGRLVDAQNFFVVDRLRSWLQSLFSQALNRISYRVELVAGVVSHLKYRTCGP 114
                  .:.||||:..:.:.::..|.                     ||         :.:...|
  Rat   267 ------SKFRELIKEEVKEIKDTDVT---------------------VE---------EEKPGSP 295

  Fly   115 AHTIYVYGDYEYSVDYVPAICLAAE---------------QNVLPTKQLECFKR----------- 153
            |.|:.:....|.|||    |.||.|               |:.|.||.....:|           
  Rat   296 AVTLLIRNPEEISVD----IILALESKGSWPISTKGGLPIQDWLGTKVRTNLRREPFYLVPKNAK 356

  Fly   154 ------------------ANTSYWE----AIPKPLKP-LTETSMISFRSSFYAVEKILLQDVHEN 195
                              ::|..||    |...|.|| |.|.......:.:..|...||.  .:.
  Rat   357 DGNRFQEKKTDKVARVFNSSTCTWEPDRWASYVPGKPGLHEHQKRQVVNWYKLVSSFLLN--RKE 419

  Fly   196 CRNAIRFM-----KKFRDVKTNLGNCKSYYIKTLFLWKIIQEPESYWLNPLSFILADMFDD---- 251
            |...::::     ::|:::.   ..| ||::||.......::|:....:|.:  |:..||.    
  Rat   420 CLKLMKYLLEQLKREFQELD---AFC-SYHVKTAIFHMWTKDPQDSQWDPRN--LSTCFDKFLTF 478

  Fly   252 LAENLRRGVITFFWDPELNMIDALTRDQVWEMYLCVQRIPRDLRGAEISRNKWSFFVLREF 312
            ..|.||...:..::.|:.|:......|:..:.:|. ::|       |..||. .|.:..:|
  Rat   479 FLECLRTEKLDHYFIPKFNLFSQELIDKKSKEFLS-EKI-------EYERNN-GFPIFNKF 530

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30424NP_001097455.1 Mab-21 1..289 CDD:281298 78/362 (22%)
CgasXP_006243501.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C54851733
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D331478at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR10656
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.