DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30424 and mab21l3

Sequence 1:NP_001097455.1 Gene:CG30424 FlyBaseID:FBgn0050424 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001103495.1 Gene:mab21l3 ZFINID:ZDB-GENE-070912-242 Length:387 Species:Danio rerio

Alignment Length:330 Identity:65/331 (20%)
Similarity:116/331 (35%) Gaps:122/331 (37%)


  Fly    32 IPGNVLLDMTRVLELLKD--------DPREDFQRIRELIQGRLVDAQNFFVVDRLRSWLQSLFSQ 88
            :.|:.||...|..|.|..        :|.:::...|..|:|.:|.|:   ||:..:..|::    
Zfish   119 LTGSRLLSPVREPEKLHQWLELESFVNPSQEWHDARMTIEGDIVPAK---VVNVFKDLLET---- 176

  Fly    89 ALNRISYRVELVAGVVSHLKYRTCGPAHTIYVYGDYEYSVDYVPAICLAAEQNVLPTKQLECFKR 153
                 |.:...:...||.|:  :.|.|..:.|    |.|...:       |..::||.:|     
Zfish   177 -----SIKTRGLTNKVSVLE--SVGTAVRVAV----ETSEAQI-------EVKLVPTVEL----- 218

  Fly   154 ANTSYWEAIPKPLK--------PLTE--------------TSMISFRSSFYAVEKILLQDVHEN- 195
              .:||   ||..:        |.||              :|...:..||...|::||.::.|: 
Zfish   219 --MNYW---PKRARWPRLFRRWPSTERARCIKSFGFNLMASSNYHWLLSFSRAEQVLLSNIDEDG 278

  Fly   196 -CRNAIRFMKKFRDVKTNLGNC-------KSYYIKTLFLWKIIQEPESYWLNPLSFILADMFDDL 252
             ||.  :..:..|.:|.: |.|       .:::::||..|...:.|                   
Zfish   279 GCRR--KCYRVVRQLKED-GWCPGSKPVITAFHLQTLLFWTCEKYP------------------- 321

  Fly   253 AENLRRGVITFFWDPELNMIDALTRDQVWEMYL-CVQRIPRDLRGAEISRNKWSFFVLREFSHKK 316
                                  .|||  |:.:. ||.|:.:.|... :|::....:.:|..:..|
Zfish   322 ----------------------CTRD--WKDFRGCVLRLVQKLHKC-VSQHYLRHYFIRSHNLLK 361

  Fly   317 ERNVN 321
            ..|.|
Zfish   362 YSNTN 366

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30424NP_001097455.1 Mab-21 1..289 CDD:281298 58/297 (20%)
mab21l3NP_001103495.1 Mab-21 82..377 CDD:281298 65/331 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10656
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.