DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30424 and cgas

Sequence 1:NP_001097455.1 Gene:CG30424 FlyBaseID:FBgn0050424 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_685111.1 Gene:cgas ZFINID:ZDB-GENE-090313-23 Length:592 Species:Danio rerio

Alignment Length:322 Identity:64/323 (20%)
Similarity:119/323 (37%) Gaps:87/323 (27%)


  Fly     2 LKIAKPNEFDLVFKLKFPY-------------YKSIAVTRDPKIPGNVLLDMTRVLELLKDDPRE 53
            |||.:|:|||::  |..|.             :.|||:.|.|                 ...|.:
Zfish   280 LKICEPDEFDVM--LTVPVERVDIQNFDEAGAFYSIALKRHP-----------------NKHPLD 325

  Fly    54 DFQRIRELIQGRLVDAQNFFVVDRLRSWLQSLFSQALNRISYRVELVAGVVSHLKYRTCGPAHTI 118
            .|     |.:.:.:.|..  ::...|..::....:|.: :.|::::      ..|...| ||.|:
Zfish   326 KF-----LNEDKTIQASE--MLSEFRDGVKKAVEKATD-LPYKIKI------QRKKPKC-PAVTL 375

  Fly   119 YV-YGDYEYSVDYVPAICLAAEQNVLPTKQLECFK------RANTSYWEAIPKPLKPLTE----- 171
            .| .|....|||:|  :.|...:...|....:.|:      |...|..:..|..|.|..|     
Zfish   376 EVTEGRKNISVDFV--LGLKVHRASWPELTKDGFRVEHWLGRKVKSTMKRQPFYLVPKYEGIGNA 438

  Fly   172 -----TSMISFRSSFYAVEKILLQD---------------VHENCRNAIRFM---KKFRDVKTN- 212
                 .:..|:|.||..:||.:|:.               ..:.|...::::   .|..:.|:| 
Zfish   439 EHDGVVARDSWRISFSHIEKEILKSHGHTKTCCEGREQKCCRKECLKLLKYLLQQLKNDESKSNK 503

  Fly   213 LGNCKSYYIKTLFLWKIIQE-PESYW-LNPLSFILADMFDDLAENLRRGVITFFWDPELNMI 272
            :.:..||:.||..|...... .:..| .:.|:.....:.:|..::|:...:..|:.|..|::
Zfish   504 MSSFCSYHAKTTLLQACASRGTDIEWAYSELANCFQQLLEDFVKHLKNHQLPNFFIPSHNLL 565

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30424NP_001097455.1 Mab-21 1..289 CDD:281298 64/323 (20%)
cgasXP_685111.1 Mab-21 276..581 CDD:281298 64/323 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C54850001
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D331478at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR10656
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.