DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30424 and LOC556707

Sequence 1:NP_001097455.1 Gene:CG30424 FlyBaseID:FBgn0050424 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_684668.2 Gene:LOC556707 ID: Length:499 Species:Danio rerio

Alignment Length:319 Identity:64/320 (20%)
Similarity:107/320 (33%) Gaps:81/320 (25%)


  Fly     5 AKPNEFDLVFKLKFPYYKSIAVTRDPKIPGNVLLDMTR--------VLELLKDDPREDFQRIREL 61
            |:..::|:.|.|..|..|    ..|...|  |.|||..        .|.|..:.....::....:
Zfish   117 ARGADYDMDFTLLVPALK----LHDRNQP--VTLDMRHSALCHSWLSLRLFDEGTINKWKDCCTM 175

  Fly    62 IQGRLVDAQNFFVVDRLRSWLQSLFSQALNRISY-------RVELV---AGVVSHLKYRTCGPAH 116
            |.........||....:..|.....|..|..|..       |||.|   |.|:|.:  ...|.:.
Zfish   176 IDHANGATNYFFSPTLVADWFYESISMVLAEIQKKPQRGVPRVEKVERNATVISII--LGVGGSR 238

  Fly   117 TIYVYGDYEYSVDYVPAICLAAEQNVLPTKQLECFKRANTSYWEAIPKPLKPLTETSMIS----- 176
            .:|         |.||.:.......|..:..:|      ..:|:.      .:||..:||     
Zfish   239 MLY---------DVVPVVSFKGWPAVAQSWLME------NHFWDG------KITEEEVISGFYLL 282

  Fly   177 ------------FRSSFYAVEKIL-------LQDVHENCRN-AIRFMKKFRDVKTNLGNCKSYYI 221
                        :|.||...|..|       |...::.|:. .|:.:.:.:.:       ..|::
Zfish   283 PACSSTGQKENEWRLSFARSEVQLKKCISASLMQAYQACKALIIKLLSRPKAI-------SPYHL 340

  Fly   222 KTLFLWKIIQEPESYWLNP--LSFILADMFDDLAENLRRGVITFFWDPELNMIDALTRD 278
            ::|.||...:.|.:|....  .:..|..:.|||...|.......::.|:.||::.|:.|
Zfish   341 RSLMLWSCDRLPHTYLAQEDYAAHFLLGLIDDLQHCLVNKTCPNYFIPQCNMLEHLSDD 399

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30424NP_001097455.1 Mab-21 1..289 CDD:281298 64/320 (20%)
LOC556707XP_684668.2 Mab-21 169..401 CDD:281298 50/262 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10656
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.