DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cGlr2 and Mab21l4

DIOPT Version :10

Sequence 1:NP_001400984.1 Gene:cGlr2 / 246606 FlyBaseID:FBgn0050424 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001102781.1 Gene:Mab21l4 / 501185 RGDID:1563692 Length:452 Species:Rattus norvegicus


Alignment Length:64 Identity:16/64 - (25%)
Similarity:31/64 - (48%) Gaps:8/64 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 KDDPR-EDFQRIRELI-----QGRLVDAQNFFVVDRLRSWLQSLFSQALNRISYRVELVAGVVS 175
            ::.|| :|:||...::     :...:|::  |:||..|......|:...:.....||::.||.|
  Rat    33 RESPRVQDYQRAENILLTVLERAHALDSR--FIVDYSRDLEAFQFALRSSEDPLDVEVLLGVDS 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cGlr2NP_001400984.1 Mab-21 69..261 CDD:460873 16/64 (25%)
Mab-21_C 265..359 CDD:466416
Mab21l4NP_001102781.1 Mab-21_C <301..369 CDD:466416
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.