DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30424 and Mb21d2

Sequence 1:NP_001097455.1 Gene:CG30424 FlyBaseID:FBgn0050424 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001102526.2 Gene:Mb21d2 RGDID:1559643 Length:491 Species:Rattus norvegicus

Alignment Length:333 Identity:64/334 (19%)
Similarity:107/334 (32%) Gaps:105/334 (31%)


  Fly     5 AKPNEFDLVFKLKFPYYKSIAVTRDPKIPGNVLLDMTR--------VLELLKD---DPREDFQRI 58
            |:..::|:.|.|..|..|    ..|...|  |.|||..        .|.|..:   ...:|...|
  Rat   109 ARGTDYDMDFTLLVPALK----LHDRNQP--VTLDMRHSALCHSWLSLRLFDEGTISKWKDCCTI 167

  Fly    59 RELIQGRLVDAQN-FFVVDRLRSWLQSLFSQALNRISYR-----------------VELVAGVVS 105
            .:.|.|    |.| ||...::..|.....|..|:.|..:                 :.::.||  
  Rat   168 ADHING----ATNYFFSPTKVADWFYDSISIVLSEIQKKPQRGMPKVEKVEKNGTIISIILGV-- 226

  Fly   106 HLKYRTCGPAHTIYVYGDYEYSVDYVPAICLAAEQNVLPTKQLECFKRANTSYWEAIPKPLKPLT 170
                   |.:..:|         |.||.:.......|..:..:|      ..:|:.      .:|
  Rat   227 -------GSSRMLY---------DIVPVVSFKGWPAVAQSWLME------NHFWDG------KIT 263

  Fly   171 ETSMISFRSSFYAVEKILLQDVHENCRNAIRFMKKFRDVKTNLGNCKS----------------- 218
            |..:|   |.||.|.....:...:|     .:...|...:..|..|.|                 
  Rat   264 EEEVI---SGFYLVPACSYKGKKDN-----EWRLSFARSEVQLKKCISGSLMQAYQACKAIIIKL 320

  Fly   219 ---------YYIKTLFLWKIIQEPESYWLNP--LSFILADMFDDLAENLRRGVITFFWDPELNMI 272
                     |:::::.||...:.|.||....  .:..|..:.|||...|...:...::.|:.||:
  Rat   321 LSRPKAISPYHLRSMMLWACDRLPVSYLAQEDYAAHFLLGLIDDLQHCLVNKMCPNYFIPQCNML 385

  Fly   273 DALTRDQV 280
            :.|:.:.|
  Rat   386 EHLSEETV 393

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30424NP_001097455.1 Mab-21 1..289 CDD:281298 64/334 (19%)
Mb21d2NP_001102526.2 Mab-21 161..401 CDD:281298 50/276 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10656
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.