DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30424 and Itpripl2

Sequence 1:NP_001097455.1 Gene:CG30424 FlyBaseID:FBgn0050424 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001028552.1 Gene:Itpripl2 MGIID:2442416 Length:535 Species:Mus musculus

Alignment Length:342 Identity:67/343 (20%)
Similarity:112/343 (33%) Gaps:103/343 (30%)


  Fly     3 KIAKPNEFDLVFKLKFPYYKSIAVTRDPKIPGNVLLDMTRVLE-----LLKDDPRED-------F 55
            ||.:|:.||::..|:.|    ..|..:|:..|.. ..:|....     .||..|...       .
Mouse   167 KIRRPDSFDVLVPLRLP----PQVALEPRSLGTE-PSLTPAFRSCFVCALKAPPSPSGASTGQWH 226

  Fly    56 QRIRELIQGRLVDAQ--NFFVVDRLRSWLQSLFSQALNRISY------RVELVAGVVSHLKYRTC 112
            :..:...:|..||.|  .......:..|.|:...::|..:.|      ||.|..|.:........
Mouse   227 RDCKPFAEGFCVDVQGRRHLSATLVLRWFQAHLQRSLATVRYSLEGRCRVSLTPGSLEQPPTLHI 291

  Fly   113 GPAHTIYVYGDYEYSVDYVPAICLAAEQNVLPTKQLECFKRANTSYWEAIPKPLKP---LTETSM 174
            .|..|.|.......:|..:||:.|                 .:..:..|.|.|..|   |:|...
Mouse   292 LPCRTDYGCCRLSMAVRLIPAVHL-----------------GDGVFLVAPPPPPSPSGALSELPG 339

  Fly   175 ISFRSSFYAV------EKIL--LQDVHENCRNAIRFMKKFRDVKTNLGNCKSYYIKTLFLWKIIQ 231
            .....:.:.|      :|:|  ||:                  :...|.|   |:|.|.|.|.::
Mouse   340 GLRAEALWGVNTARQEQKLLGWLQE------------------RAPPGAC---YLKCLQLLKALR 383

  Fly   232 EPESYWLNPL----------SFILADMFDDLAENLRRGVITFFWDPELNMIDALTRDQVWEMYL- 285
            :..:..|:|:          |::|....  |...|..|..|..||               |.:| 
Mouse   384 DLGARGLDPMAATHWGRILSSYVLKTAV--LEVLLNEGSPTPSWD---------------EAHLS 431

  Fly   286 -CVQRIPRDLRGAEISR 301
             |::::.:.||...:.|
Mouse   432 ECLEKLVKFLRDCLLRR 448

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30424NP_001097455.1 Mab-21 1..289 CDD:281298 64/329 (19%)
Itpripl2NP_001028552.1 Mab-21 163..496 CDD:281298 67/343 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C54836807
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10656
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.