DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30424 and CG4766

Sequence 1:NP_001097455.1 Gene:CG30424 FlyBaseID:FBgn0050424 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_572287.1 Gene:CG4766 FlyBaseID:FBgn0027546 Length:368 Species:Drosophila melanogaster

Alignment Length:345 Identity:74/346 (21%)
Similarity:129/346 (37%) Gaps:110/346 (32%)


  Fly     2 LKIAKPNEFDLVFKLKFPYYKSIAV---TRDPKIPGNVLLDMTRVLELLKDDPREDFQRIRELIQ 63
            :::..||||::|.     |...:.|   ..|..:||..:|.::            |.::....:.
  Fly    72 VEVISPNEFEIVL-----YLNQMGVFNFVDDGTLPGCAVLKLS------------DGRKRSMSLW 119

  Fly    64 GRLVDAQNFFVVDRLRSWLQSLFSQALNRISYR--VELVAGVVSHLKYRTCGPAHTIYVYGDYEY 126
            ...:.|..:....::|:..|:|.:||.::..||  |::| |..|.:|.|.           ...:
  Fly   120 VEFITASGYLSSRKIRARFQTLVAQACDKSVYRDMVKMV-GDTSEVKLRI-----------RERF 172

  Fly   127 SVDYVPAI-CLAAEQNVLPTKQLECFKRANTSYWEAIPKPLKP-----------------LTETS 173
            .|...||. |    ..:.|         .:.::|   |.|..|                 |::.|
  Fly   173 VVQITPAFKC----SGIWP---------RSAAHW---PVPHLPWPHPNIVAEVKTEGFDLLSKES 221

  Fly   174 MI--------------SFRSSFYAVEKILLQDVHENC-RNAIRFMKKFRDVKTNL-GN-CKSYYI 221
            :|              ::..||:..|..|||.   .| |..:..:|..||...:| || ..:|::
  Fly   222 VIMQNKNNNAASMEGDAWVLSFFEAENRLLQG---GCRRRCLSMLKTLRDRHLDLPGNPISAYHL 283

  Fly   222 KTLFLWKIIQEPESY-WLNPLSFILAD----MFDDLAENLRRGVITFFWDPELNMI-----DALT 276
            |.|.|::..:.|..: |...   .:||    :|..|...|:......::.|.|:|.     .||.
  Fly   284 KNLLLYECEKHPRDFEWDEG---CIADRINGIFLQLISCLQYRRCPHYFLPALDMFKGKSPSALE 345

  Fly   277 R--DQVWEMYLCVQRIPRDL 294
            :  .|||       |:.|:|
  Fly   346 QAAKQVW-------RLTREL 358

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30424NP_001097455.1 Mab-21 1..289 CDD:281298 71/339 (21%)
CG4766NP_572287.1 Mab-21 68..353 CDD:281298 71/339 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1995583
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10656
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.