DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30424 and Mab21l3

Sequence 1:NP_001097455.1 Gene:CG30424 FlyBaseID:FBgn0050424 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001099926.1 Gene:Mab21l3 RGDID:1308694 Length:429 Species:Rattus norvegicus

Alignment Length:322 Identity:67/323 (21%)
Similarity:117/323 (36%) Gaps:95/323 (29%)


  Fly     2 LKIAKPNEFDLVFKLK-FPYYKSIAVTRDPK-----IPGNVLLDMTRVLELLKDDPREDFQR--- 57
            :|:..|:.|.:...|: ...||.:   |.|:     :.|..|....|       || |..|:   
  Rat   129 IKVLAPSLFHVTVPLRGLAGYKGV---RTPRWRYYSLQGTKLSCPLR-------DP-EGLQQWLE 182

  Fly    58 ----IRELIQGRLVDA--QNFFVVDRLRSWLQSLFSQALNRISYRVELVAGVVSHLKYRTCGPAH 116
                ::.|.|...||.  :...|..::....|.|...|:     |...::|.|:.|:.||     
  Rat   183 TETFMKTLWQWHKVDVNIEGDIVPAKVLQIFQMLVENAV-----RTCHLSGKVTVLEKRT----- 237

  Fly   117 TIYVYGDYEYSVDYVPAICLAAEQNVLPTKQL-----------ECFKRANTSYWEAIPKPLK--- 167
            |::|  ..|.|...|       |..:.||.::           .|.||     |   |.|.:   
  Rat   238 TVWV--AVETSTGQV-------ELELAPTVEIPTTWPEKAQWPRCLKR-----W---PSPERVEC 285

  Fly   168 ------PLTETSMISFRSSFYAVEKILLQDVHEN--CRNAIRFMKKFRDVKTNLGNC-------K 217
                  .|...|...::.||...|::|.:.:.|:  ||.  |..:..|.:|.::. |       .
  Rat   286 IKSFGFNLVAQSTYHWQLSFSQAERVLCEQLDEDGGCRR--RCFQVLRQLKEDVW-CPGRRPVIT 347

  Fly   218 SYYIKTLFLWKIIQEPE-SYWLNPLSFILADMFDDLAENLRRGV----ITFFWDPELNMIDA 274
            :::::|:..|...:.|. ..|.     :....|..|...|.|.|    :..::.|:.|:..:
  Rat   348 THHLQTVLFWTCEKYPHLKDWQ-----VFHQAFLRLVRKLHRCVSQHFLKHYFVPKSNLFQS 404

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30424NP_001097455.1 Mab-21 1..289 CDD:281298 67/323 (21%)
Mab21l3NP_001099926.1 Mab-21 125..418 CDD:281298 67/323 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10656
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.