DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30424 and TMEM102

Sequence 1:NP_001097455.1 Gene:CG30424 FlyBaseID:FBgn0050424 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001307373.1 Gene:TMEM102 HGNCID:26722 Length:508 Species:Homo sapiens

Alignment Length:118 Identity:23/119 (19%)
Similarity:36/119 (30%) Gaps:31/119 (26%)


  Fly   150 CFKRANTSYWEAIPKPLKPLTETSMISFRSSFYAVEKILLQDVHENCRNAIRFMKKFRDVKTNLG 214
            ||.|...:....||.||            ...:|..:.||:.:....|.|               
Human   366 CFARQELALKARIPAPL------------LQAHAAAQALLRPLVAGTRAA--------------- 403

  Fly   215 NCKSYYIKTLFLWKIIQEPESYWLNP--LSFILADMFDDLAENLRRGVITFFW 265
              ..|.::||..|...:.|..|...|  .......:.|:|...|..|.:..::
Human   404 --APYLLRTLLYWACERLPALYLARPENAGACCLGLLDELGRVLEAGTLPHYF 454

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30424NP_001097455.1 Mab-21 1..289 CDD:281298 23/119 (19%)
TMEM102NP_001307373.1 Mab-21 <317..455 CDD:308741 23/119 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10656
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.