DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30424 and Mab21l3

Sequence 1:NP_001097455.1 Gene:CG30424 FlyBaseID:FBgn0050424 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_758499.3 Gene:Mab21l3 MGIID:2446273 Length:429 Species:Mus musculus

Alignment Length:282 Identity:57/283 (20%)
Similarity:103/283 (36%) Gaps:97/283 (34%)


  Fly     2 LKIAKPNEFDLVFKLK------------FPYY-----KSIAVTRDPKIPG-NVLLDMTRVLELLK 48
            :|:..|:.|.:...||            :.||     |.....|||:  | ...|:....::.|.
Mouse   129 IKVLAPSLFHVTVPLKGLAGYKGVQRQRWRYYNVQGAKLTCPLRDPE--GLQQWLETEMFMKTLW 191

  Fly    49 DDPREDFQRIRELIQGRLVDAQNFFVVDRLRSWLQSLFSQALNRISYRVELVAGVVSHLKYRTCG 113
            ...:.|..     |:|.:|.|:   |:...|:.:::         :.|...::|.|:.|:.||  
Mouse   192 QWHKADVN-----IEGDIVPAK---VLQVFRTLVEN---------AVRTCHLSGKVTVLEKRT-- 237

  Fly   114 PAHTIYVYGDYEYSVDYVPAICLAAEQNVLPTKQL-----------ECFKRANTSYWEAIPKPLK 167
               |::|  ..|.|...|       |..:.||.::           .|.||     |   |.|.:
Mouse   238 ---TVWV--AMETSTGQV-------ELELAPTVEIPTTWPEKAQWPRCLKR-----W---PSPER 282

  Fly   168 ---------PLTETSMISFRSSFYAVEKILLQDVHEN------CRNAIRFMKK------FRDVKT 211
                     .|...|...::.||...|::|.:.:.|:      |...:|.:|:      .|.|.|
Mouse   283 VECIKSFGFNLVAQSAYHWQLSFSQAEQVLFEQLDEDGGCRRQCFQVLRQLKEDVWCPGRRPVIT 347

  Fly   212 NLGNCKSYYIKTLFLWKIIQEP 233
                  :::::|:..|...:.|
Mouse   348 ------THHLQTVLFWTCEKYP 363

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30424NP_001097455.1 Mab-21 1..289 CDD:281298 57/283 (20%)
Mab21l3NP_758499.3 Mab-21 125..418 CDD:281298 57/283 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10656
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.