DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30424 and Cgas

Sequence 1:NP_001097455.1 Gene:CG30424 FlyBaseID:FBgn0050424 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_775562.2 Gene:Cgas MGIID:2442261 Length:507 Species:Mus musculus

Alignment Length:326 Identity:74/327 (23%)
Similarity:124/327 (38%) Gaps:110/327 (34%)


  Fly     2 LKIAKPNEFDLVFKLKFP------YYKSIA--VTRDPKIP-GNVL--------LDMTRVLELLKD 49
            :||:.|||||::|||:.|      ||::.|  :.:..:|| ||.|        |..|::|...:.
Mouse   204 VKISAPNEFDVMFKLEVPRIELQEYYETGAFYLVKFKRIPRGNPLSHFLEGEVLSATKMLSKFRK 268

  Fly    50 DPREDFQRIRELIQGRLVDAQNFFVVDRLRSWLQSLFSQALNRISYRVELVAGVVSHLKYRTCGP 114
            ..:|:.:.|::              :|                           ||..|.:...|
Mouse   269 IIKEEVKEIKD--------------ID---------------------------VSVEKEKPGSP 292

  Fly   115 AHTIYVYGDYEYSVDYVPAICLAAE---------------QNVLPTKQLECFKRANTSYWEAIPK 164
            |.|:.:....|.|||    |.||.|               |..|.||.....:|   ..:..:||
Mouse   293 AVTLLIRNPEEISVD----IILALESKGSWPISTKEGLPIQGWLGTKVRTNLRR---EPFYLVPK 350

  Fly   165 PLKPLTETSMISFRSSFYAVEKILLQD--VHENC----------RNAIRFM--------KKFRDV 209
            ..|........::|.||...||.:|.:  :.:.|          :..::.|        |:|:::
Mouse   351 NAKDGNSFQGETWRLSFSHTEKYILNNHGIEKTCCESSGAKCCRKECLKLMKYLLEQLKKEFQEL 415

  Fly   210 KTNLGNCKSYYIKTLFLWKIIQEPESYWLNPLSFILADMFDDL----AENLRRGVITFFWDPELN 270
            .   ..| ||::||.......|:|:....:|.:  |:..||.|    .|.||...:..::.|:.|
Mouse   416 D---AFC-SYHVKTAIFHMWTQDPQDSQWDPRN--LSSCFDKLLAFFLECLRTEKLDHYFIPKFN 474

  Fly   271 M 271
            :
Mouse   475 L 475

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30424NP_001097455.1 Mab-21 1..289 CDD:281298 74/327 (23%)
CgasNP_775562.2 DNA-binding. {ECO:0000269|PubMed:28363908} 1..146
Required for association with the cell membrane. {ECO:0000250|UniProtKB:Q8N884} 48..59
Required for activation upon DNA viral infection. {ECO:0000269|PubMed:28314590} 119..132
DNA-binding. {ECO:0000244|PDB:5N6I, ECO:0000269|PubMed:23647843, ECO:0000269|PubMed:28902841, ECO:0000269|PubMed:28963528} 158..201
Mab-21 200..495 CDD:281298 74/327 (23%)
Nuclear localization signal. {ECO:0000250|UniProtKB:Q8N884} 281..291 4/37 (11%)
DNA-binding. {ECO:0000244|PDB:5N6I, ECO:0000269|PubMed:23647843, ECO:0000269|PubMed:28902841, ECO:0000269|PubMed:28963528} 372..395 3/23 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C54850817
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR10656
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.