DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30424 and Mab21l1

DIOPT Version :9

Sequence 1:NP_001097455.1 Gene:CG30424 / 246606 FlyBaseID:FBgn0050424 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_034880.1 Gene:Mab21l1 / 17116 MGIID:1333773 Length:359 Species:Mus musculus


Alignment Length:279 Identity:58/279 - (20%)
Similarity:98/279 - (35%) Gaps:96/279 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKIAKPNEFDLVFKLKFPYYKSIAV---TRDPKIPGNVLLDMTRVLELLKDDPREDFQRIRELIQ 63
            |::..|.||::|.     |...:.|   ..|..:||..:|.::            |.::....:.
Mouse    66 LEVISPTEFEVVL-----YLNQMGVFNFVDDGSLPGCAVLKLS------------DGRKRSMSLW 113

  Fly    64 GRLVDAQNFFVVDRLRSWLQSLFSQALNRISYR--VELVAGVVSHLKYRTCGPAHTIYVYGDYEY 126
            ...:.|..:....::||..|:|.:||:::.|||  |::||. .|.:|.|...           .|
Mouse   114 VEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVKMVAD-TSEVKLRIRD-----------RY 166

  Fly   127 SVDYVPAI-CLAAEQNVLPTKQLECFKRANTSYWEAIPKPLKP------LTETSMISFRSSFYAV 184
            .|...||. |    ..:.|         .:.::|   |.|..|      :.|.....|       
Mouse   167 VVQITPAFKC----TGIWP---------RSAAHW---PLPHIPWPGPNRVAEVKAEGF------- 208

  Fly   185 EKILLQDVH---------------------EN------CR-NAIRFMKKFRDVKTNLGN--CKSY 219
             .:|.::.|                     ||      || ..:..:|..||....|..  ..:|
Mouse   209 -NLLSKECHSLAGKQSSAESDAWVLQFAEAENRLQMGGCRKKCLSILKTLRDRHLELPGQPLNNY 272

  Fly   220 YIKTLFLWKIIQEP-ESYW 237
            ::|||..::..:.| ||.|
Mouse   273 HMKTLVSYECEKHPRESDW 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30424NP_001097455.1 Mab-21 1..289 CDD:281298 58/279 (21%)
Mab21l1NP_034880.1 Mab-21 62..344 CDD:397398 58/279 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.