DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30424 and ITPRIPL2

Sequence 1:NP_001097455.1 Gene:CG30424 FlyBaseID:FBgn0050424 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001030013.1 Gene:ITPRIPL2 HGNCID:27257 Length:535 Species:Homo sapiens

Alignment Length:351 Identity:69/352 (20%)
Similarity:112/352 (32%) Gaps:119/352 (34%)


  Fly     3 KIAKPNEFDLVFKLKFPYYKSI---AVTRDP--------------KIP--------GNVLLDMTR 42
            ||.:|:.||::..|:.|...::   ::..:|              |.|        |:.|.|...
Human   167 KIRRPDSFDVLVPLRLPPLVALEPRSLGEEPALAPAFRGCFLCALKAPPSPSGASGGHWLRDCKP 231

  Fly    43 VLELLKDDPREDFQRIRELIQGRLVDAQNFFVVDRLRSWLQSLFSQALNRISY------RVELVA 101
            ..:....|.|.     |..:...||          || |.||...::|..:.|      ||.|..
Human   232 FADAFCVDVRG-----RRHLSATLV----------LR-WFQSHLQRSLATVRYSLEGRCRVTLTP 280

  Fly   102 GVVSHLKYRTCGPAHTIYVYGDYEYSVDYVPAICLAAEQNVLPTKQLECFKRANTSYWEAIPKPL 166
            |.:.........|..|.|.......:|..:||:.|                 .:..:..|.|.| 
Human   281 GGLEQPPTLHILPCRTDYGCCRLSMAVRLIPAVHL-----------------GDGVFLVAPPPP- 327

  Fly   167 KPLTETSMISFRSSFYA----------VEKILLQDVHENCRNAIRFMKKFRDVKTNLGNCKSYYI 221
             ||....::.......|          .|:.||..:.|               :...|.|   |:
Human   328 -PLPSAPLLELPEGLRAEALWGVNTARQEQKLLSWLQE---------------RAAPGAC---YL 373

  Fly   222 KTLFLWKIIQE---------PESYWLNPL-SFILADMFDDLAENLRRGVITFFWDPELNMIDALT 276
            |.|.|.|.:::         ..:.|...| |::|..:.  ||..||:|.....||.|        
Human   374 KCLQLLKALRDLGARGLDSAAATQWGRILSSYVLKTVL--LAVLLRKGAPGQGWDEE-------- 428

  Fly   277 RDQVWEMYLCVQRIPRDLRGAEISRN 302
                 .:..|::.:.:.||...:.|:
Human   429 -----HLGRCLEELVQFLRDCLLRRH 449

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30424NP_001097455.1 Mab-21 1..289 CDD:281298 66/337 (20%)
ITPRIPL2NP_001030013.1 Mab-21 246..453 CDD:308741 53/268 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C54845560
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10656
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.