DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30424 and mab21l2

DIOPT Version :9

Sequence 1:NP_001097455.1 Gene:CG30424 / 246606 FlyBaseID:FBgn0050424 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_694507.1 Gene:mab21l2 / 117234 ZFINID:ZDB-GENE-011101-3 Length:359 Species:Danio rerio


Alignment Length:261 Identity:55/261 - (21%)
Similarity:102/261 - (39%) Gaps:60/261 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKIAKPNEFDLVFKLKFPYYKSIAV---TRDPKIPGNVLLDMTRVLELLKDDPREDFQRIRELIQ 63
            :::..||||::|.     |...:.|   ..|..:||..:|.::            |.::....:.
Zfish    66 MEVIAPNEFEVVL-----YLNQMGVFNFVDDGSLPGCAVLKLS------------DGRKRSMSLW 113

  Fly    64 GRLVDAQNFFVVDRLRSWLQSLFSQALNRISYR--VELVAGVVSHLKYRTCGPAHTIYVYGDYEY 126
            ...:.|..:....::||..|:|.:||:::.|||  |::||. .|.:|.|.           ...|
Zfish   114 VEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVKMVAD-TSEVKLRI-----------RERY 166

  Fly   127 SVDYVPAI-CL------AAE----------QNVLPTKQLECFKRANTSYWEAIPKPLKPLTETSM 174
            .|...||. |.      ||:          .|.:...:.|.|...:...:....|.....::..:
Zfish   167 VVQITPAFKCTGIWPRSAAQWPMPHIPWPGPNRVAEVKAEGFNLLSKECYSLTGKQSSAESDAWV 231

  Fly   175 ISFRSSFYAVEKILLQDVHENCRNAIRFMKKFRDVKTNLGN--CKSYYIKTLFLWKIIQEP-ESY 236
            :.|..   |..::|:....:.|   :..:|..||....|..  ..:|::|||.|::..:.| |:.
Zfish   232 LQFAE---AENRLLMSGCRKKC---LSVLKTLRDRHLELPGQPLNNYHMKTLLLYECEKHPRETD 290

  Fly   237 W 237
            |
Zfish   291 W 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30424NP_001097455.1 Mab-21 1..289 CDD:281298 55/261 (21%)
mab21l2NP_694507.1 Mab-21 62..344 CDD:397398 55/261 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.