DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30424 and Itprip

DIOPT Version :9

Sequence 1:NP_001097455.1 Gene:CG30424 / 246606 FlyBaseID:FBgn0050424 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_003749183.1 Gene:Itprip / 100912218 RGDID:6488464 Length:557 Species:Rattus norvegicus


Alignment Length:251 Identity:49/251 - (19%)
Similarity:94/251 - (37%) Gaps:57/251 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 RLRSWLQSLFSQALNRIS--YRVELVAGVVS-----HLKYRTCGPAHTIYVYGDYEYSVDYVPAI 134
            ::..|.|:..::|.:|||  |..:|..|.:.     .:|:|                |..::|.:
  Rat   304 QVMKWFQTALTKAWHRISHKYEFDLAFGELDTPGSLKIKFR----------------SGKFMPFV 352

  Fly   135 CLAAEQNVLPTKQLECFKRANTSYWEAIPK-PLK--PLTETS-MISF----RSSFYAVEKILLQD 191
            .         |..::| ..::..:...:|| |.:  |.:.|. ::||    |.......|.|.:.
  Rat   353 L---------TPVIQC-NDSDLYFTSQLPKEPCRGAPASNTDWLLSFAVYERQFLRMTAKALPEG 407

  Fly   192 V-HENCRNAIRFMKKFRDVKTNLGNCKSYYIKTLFLWKIIQEPESYW-LNPLSFILADMFDDLAE 254
            . |.:|.....|:...:...|.......|::||..|..::....:.| .:.|...|.::|..|..
  Rat   408 ACHLSCLQIASFLLSKQSRLTGPSGLSDYHLKTALLHLLLSRQAADWKTSQLDVRLQELFCFLER 472

  Fly   255 NLRRGVITFFWDPELNMIDALTRDQVWEMYLCVQRIPRDLRGAEISRNKWSFFVLR 310
            :|....:..|:.....:.:|:             .:|..:|.|| ..|.:..|||:
  Rat   473 SLLEKKLHHFFVGNHKVPEAM-------------GLPEVVRRAE-PLNLFRSFVLQ 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30424NP_001097455.1 Mab-21 1..289 CDD:281298 41/228 (18%)
ItpripXP_003749183.1 Mab-21 <370..487 CDD:281298 25/116 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342456
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.