DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30424 and tmem102

Sequence 1:NP_001097455.1 Gene:CG30424 FlyBaseID:FBgn0050424 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001314791.1 Gene:tmem102 ZFINID:ZDB-GENE-160728-39 Length:522 Species:Danio rerio

Alignment Length:435 Identity:86/436 (20%)
Similarity:137/436 (31%) Gaps:139/436 (32%)


  Fly     5 AKPNEFDLVFKLKFPYYKSIAVTRDPKIPGNVLLDMTRV------LELLKDDP------------ 51
            ||..:|||.|.|..|..|    ..|...|  |.|||...      |.|...||            
Zfish   106 AKGVDFDLDFTLLVPALK----LHDRNQP--VTLDMRHSPPCHSWLSLRLCDPTMLARWHICCQD 164

  Fly    52 ---------REDFQRIRELIQGRLVDAQN-------FFVVDRLRSWLQSLFSQALNRISYRVELV 100
                     .||.:.....::|.:...|.       :|....:..|..|:...|:..:  |....
Zfish   165 ENNRDNKDEEEDEEDETGALRGSIPSLQPPQSLDGCYFSPLLVADWFWSVVVTAVEEL--RQNPQ 227

  Fly   101 AGVVSHLKYRTCGPAHT-IYVYGDYEYSVDYVPAICL----AAEQNVLPTKQLECFKRANTSYWE 160
            .|:....:....||..| |...|......|.:|.:..    |..|..|.|..          :|:
Zfish   228 RGIPVPDRVERNGPLTTLILTAGTSRILYDLLPVVSFRGWPAVAQGWLTTNH----------FWD 282

  Fly   161 AIPKPLKPLTETSMISFRSSFY-------AVEKILLQDVH---ENCRNAIRFMK--------KFR 207
            .      .:||...|   |.||       ||...:..|..   ...|:.::..|        .|:
Zfish   283 G------KITEEEAI---SGFYLLPCCSPAVSSSIRPDREWRLAYSRSEVQLKKCVPYPMAQAFQ 338

  Fly   208 DVKTNLGNCKS--------YYIKTLFLWKIIQEPESYWLNPLSFILADMF----DDLAENLRRGV 260
            ..|..|....:        |:::||..|...:.|.:|...|.....|.:|    ||||..:....
Zfish   339 AAKAVLSRLLARPRTGLSLYHLRTLMFWACDRLPSTYLSCPDHETPARLFLGLLDDLAHCILGKN 403

  Fly   261 ITFFWDPELNMIDALTRDQVWEMYLCVQRIPRDLRGAEISRNKWSFFVLREFSH-KKERNVNLKC 324
            ...::.|:.||::.|:                         :..:..|.|:.:| :.:...:|:.
Zfish   404 CPNYFLPQCNMLEHLS-------------------------DSAALLVARKLAHLRSDPAEHLRA 443

  Fly   325 SSRRKRNVIKGLKTTSICKLR----NARTNGTWTAGLWTRPGHAY 365
            :..:.:..         |:|:    .|.:||.   || :.|..||
Zfish   444 ALDQAQQA---------CQLKREAAGAASNGN---GL-SSPSQAY 475

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30424NP_001097455.1 Mab-21 1..289 CDD:281298 72/353 (20%)
tmem102NP_001314791.1 Mab-21 <201..432 CDD:281298 51/277 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10656
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.