DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30424 and cgas

Sequence 1:NP_001097455.1 Gene:CG30424 FlyBaseID:FBgn0050424 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_002937200.2 Gene:cgas XenbaseID:XB-GENE-6466735 Length:590 Species:Xenopus tropicalis

Alignment Length:367 Identity:89/368 (24%)
Similarity:136/368 (37%) Gaps:120/368 (33%)


  Fly     2 LKIAKPNEFDLVFKLKFP--------------YYKSIAVTRDPKIPGNVLLDMTRVLELLKDDPR 52
            :||:||||||::  ||.|              :| ::.:.|:||.|      :|..:|..|...:
 Frog   295 VKISKPNEFDIM--LKIPCGRLRISESDASGSFY-TLTINRNPKHP------LTNYVENGKISGQ 350

  Fly    53 EDFQRIRELIQGRLVDAQNFFVVDRLRSWLQSLFSQALNRISYRVELVAGVVSHLKYRTCGPAHT 117
            :...|:||||:.:|                 |.....:|     ||         :.....||.|
 Frog   351 QMLDRLRELIKSKL-----------------SRLGTGIN-----VE---------RRNAASPAVT 384

  Fly   118 IYVYGDYEYSVDYVPAICLAAE-QNVLPTKQLECFK-------RANTSY-WEAIPKPLKPLTETS 173
            |.:   .|.|||.|    ||.| :...|:...|..|       :....| :|.:....|.|..|.
 Frog   385 IKI---GEISVDLV----LALEVEGSWPSSTSEGMKIETWLGAKVKRDYKFEPMYFVAKQLKNTE 442

  Fly   174 MISFRSSFYAVEKILLQDVHEN------------CR-NAIRFMKKFRDVKTNLGN------CKSY 219
            .|.:|.||..:||.:|:: |.|            || ..::.||...:...:.||      | ||
 Frog   443 EILWRISFSHIEKEILKN-HGNAKTCCETEGVKCCRKQCLKLMKYLLEQLKSKGNRNMTHFC-SY 505

  Fly   220 YIKTLFLWKIIQEPESYWLNPLSFILADMFD----DLAENLRRGVITFFWDPELNMIDALTRDQV 280
            :.||..|......|:.....|..  ||..||    |..:.|:...:..|:.|.||:...      
 Frog   506 HAKTALLHSCTLYPKDDDWRPKD--LAACFDRYIEDFMKCLKDARLPNFFIPSLNLFSE------ 562

  Fly   281 WEMYLCVQRIPRDLRGAEISRNKWSFFVLREFSHKKERNVNL 322
                   :.||:          |...::||:...:|:....|
 Frog   563 -------ELIPK----------KCLDYLLRKLDKQKKLQYTL 587

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30424NP_001097455.1 Mab-21 1..289 CDD:281298 82/333 (25%)
cgasXP_002937200.2 WD-3 233..>337 CDD:286806 15/45 (33%)
Mab-21 291..579 CDD:281298 87/358 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D331478at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.