DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tbrd-3 and AT1G17790

Sequence 1:NP_726307.1 Gene:tbrd-3 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_564037.1 Gene:AT1G17790 AraportID:AT1G17790 Length:487 Species:Arabidopsis thaliana

Alignment Length:299 Identity:86/300 (29%)
Similarity:130/300 (43%) Gaps:72/300 (24%)


  Fly    17 CKVIIKRLFSSTYKNIAWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLNTGCYLSAADFAKD 81
            |..::.:|..  :|: ||||..|:|.:.|||||||.||:|||||.||:.:|....|.|..|||:|
plant   136 CNSLLTKLMK--HKS-AWVFNVPVDAKGLGLHDYHNIVKEPMDLGTVKTKLGKSLYKSPLDFAED 197

  Fly    82 IRLIFYNTYLYTNPDHLCYHMAKQLQIIFEEMYSQVQLYICSSGSKVRAEEESSSDESDSSSPED 146
            :||.|.|..||....|..|..|:.|..:||:.:..:::...:...|.:              |..
plant   198 VRLTFNNAILYNPIGHDVYRFAELLLNMFEDKWVSIEMQYDNLHRKFK--------------PTR 248

  Fly   147 EVNGSEVSPSIMGAP---------PSCTPTTECTPTP-----------DW----------TPPAT 181
            ::.....:|||  ||         ||.:|::...|.|           .|          .|.|.
plant   249 DIEFPAPAPSI--APIVEPLPAIVPSPSPSSPPPPPPPPVAAPVLENRTWEREESMTIPVEPEAV 311

  Fly   182 L---ETSEQQEPFTTEEDLDLHAK------IQQLDGEVLLHVIHFIQRMEGAEYCNK--ELEFDI 235
            :   |.:|::|......||.|..|      :|.|..:.|..|:..|:: ...|...|  |:|.||
plant   312 ITAPEKAEEEEAPVNNRDLTLEEKRRLSEELQDLPYDKLETVVQIIKK-SNPELSQKDDEIELDI 375

  Fly   236 CKLKVHT-------KRGIRDYLASK----GFTGKRVART 263
            ..|.::|       ..|.::.|:.|    ||..:|.|.:
plant   376 DSLDINTLWELYRFVTGYKESLSKKNEAHGFGSERDAES 414

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 44/97 (45%)
AT1G17790NP_564037.1 Bromodomain 133..230 CDD:295360 44/97 (45%)
BET 329..391 CDD:293640 17/63 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2184
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126719
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.950

Return to query results.
Submit another query.