DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tbrd-3 and BRD3

Sequence 1:NP_726307.1 Gene:tbrd-3 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_031397.1 Gene:BRD3 HGNCID:1104 Length:726 Species:Homo sapiens

Alignment Length:349 Identity:92/350 (26%)
Similarity:143/350 (41%) Gaps:95/350 (27%)


  Fly    11 SPEINACKVIIKRLFSSTYKNIAWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLNTGCYLSA 75
            |..:..|..|::.:.|..:...||.||:|:|.:.|.|||||:|::.|||||||:.:::...|..|
Human   309 SEHLRYCDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLSTVKRKMDGREYPDA 373

  Fly    76 ADFAKDIRLIFYNTYLYTNPDHLCYHMAKQLQIIFEEMYSQV-------------QLYICSSGSK 127
            ..||.|:||:|.|.|.|..|||....||::||.:||..::::             ...:.|.|::
Human   374 QGFAADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPVEAPALPAPAAPMVSKGAE 438

  Fly   128 -VRAEEESSSDESDSSSPE---------------------------------------------- 145
             .|:.||||||...|.|.|                                              
Human   439 SSRSSEESSSDSGSSDSEEERATRLAELQEQLKAVHEQLAALSQAPVNKPKKKKEKKEKEKKKKD 503

  Fly   146 ------------DEVNGSEVSPSIMGAPPSCTPTTECTPTP---------DWTPPATLETSEQQE 189
                        :|...::|:|....|.....|..:...|.         .....|:.::.|::|
Human   504 KEKEKEKHKVKAEEEKKAKVAPPAKQAQQKKAPAKKANSTTTAGRQLKKGGKQASASYDSEEEEE 568

  Fly   190 --PFTTEEDLDLHAKIQQLDGEVLLHVIHFIQRMEGA--EYCNKELEFDICKLKVHTKRGIRDYL 250
              |.:.:|...|...|.:|.||.|..|:|.||..|.:  :....|:|.|...||..|.|.:..|:
Human   569 GLPMSYDEKRQLSLDINRLPGEKLGRVVHIIQSREPSLRDSNPDEIEIDFETLKPTTLRELERYV 633

  Fly   251 AS-------KGFTG---KRVARTK 264
            .|       |.|:.   |:.|::|
Human   634 KSCLQKKQRKPFSASGKKQAAKSK 657

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 43/101 (43%)
BRD3NP_031397.1 Bromo_Brdt_I_like 34..140 CDD:99929
Acetylated histone H3 binding. {ECO:0000269|PubMed:27105114} 78..80
Bromo_Brdt_II_like 311..412 CDD:99930 43/101 (43%)
BET 571..635 CDD:293640 21/64 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000242
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126719
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.800

Return to query results.
Submit another query.