DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tbrd-3 and BRD2

Sequence 1:NP_726307.1 Gene:tbrd-3 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001186384.1 Gene:BRD2 HGNCID:1103 Length:836 Species:Homo sapiens

Alignment Length:417 Identity:104/418 (25%)
Similarity:148/418 (35%) Gaps:166/418 (40%)


  Fly    11 SPEINACKVIIKRLFSSTYKNIAWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLNTGCYLSA 75
            |.::..|..|:|.|.|..:...||.||:|:|...|||||||:|::.|||||||:.::....|..|
Human   347 SEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDA 411

  Fly    76 ADFAKDIRLIFYNTYLYTNPDHLCYHMAKQLQIIFEEMYSQV--------QLYICS--------- 123
            .:||.|:||:|.|.|.|..|||....||::||.:||..|:::        .|.:.:         
Human   412 QEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPDEPLEPGPLPVSTAMPPGLAKS 476

  Fly   124 --------SGSKVRAEEESSSDESDSSSPEDEVNGSE---------------------------- 152
                    |.|:..:|||...||.|....|.|.:.||                            
Human   477 SSESSSEESSSESSSEEEEEEDEEDEEEEESESSDSEEERAHRLAELQEQLRAVHEQLAALSQGP 541

  Fly   153 ----------------------------------------------------------VSPSIMG 159
                                                                      :.||..|
Human   542 ISKPKRKREKKEKKKKRKAEKHRGRAGADEDDKGPRAPRPPQPKKSKKASGSGGGSAALGPSGFG 606

  Fly   160 ---------------------APP-------SC--TPTTE-------CTPTPDWTPPA-----TL 182
                                 .||       ||  .|:::       .|.|   .|||     ..
Human   607 PSGGSGTKLQAGVQWRDLGLLQPPLLGFKRFSCLSLPSSQDYRLPKKATKT---APPALPTGYDS 668

  Fly   183 ETSEQQEPFTTEEDLDLHAKIQQLDGEVLLHVIHFIQRMEGA--EYCNKELEFDICKLKVHTKRG 245
            |..|:..|.:.:|...|...|.:|.||.|..|:|.||..|.:  :...:|:|.|...||..|.|.
Human   669 EEEEESRPMSYDEKRQLSLDINKLPGEKLGRVVHIIQAREPSLRDSNPEEIEIDFETLKPSTLRE 733

  Fly   246 IRDYLAS-------KGFTGKR-VARTK 264
            :..|:.|       |.:|.|: |.:||
Human   734 LERYVLSCLRKKPRKPYTIKKPVGKTK 760

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 46/101 (46%)
BRD2NP_001186384.1 Bromo_Brdt_I_like 74..180 CDD:99929
Bromo_Brdt_II_like 349..450 CDD:99930 46/101 (46%)
GVQW 616..>651 CDD:290611 5/35 (14%)
BET 676..740 CDD:293640 21/64 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000242
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126719
Panther 1 1.100 O PTHR22880
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.