DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-3 and Brd4

DIOPT Version :9

Sequence 1:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001094373.1 Gene:Brd4 / 362844 RGDID:1307282 Length:1403 Species:Rattus norvegicus


Alignment Length:329 Identity:92/329 - (27%)
Similarity:139/329 - (42%) Gaps:81/329 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QETERSSPEINACKVIIKRLFSSTYKNIAWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLNT 69
            :::.:.|.::..|..|:|.:|:..:...||.||:|:|.:.||||||.:|::.|||:||::.:|.:
  Rat   346 EKSSKISEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLES 410

  Fly    70 GCYLSAADFAKDIRLIFYNTYLYTNPDHLCYHMAKQLQIIFEEMYSQV------QLYICSS---- 124
            ..|..|.:|..|:||:|.|.|.|..|||....||::||.:||..::::      .:...||    
  Rat   411 REYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPEEPVVTVSSPAVP 475

  Fly   125 -GSKVRAEEESSSDESDSSSPEDEVNG----------SEVSPSIMGA------------------ 160
             .:||.|...||...|||||..|....          :|:...:...                  
  Rat   476 PPTKVVAPPSSSDSSSDSSSDSDSSTDDSEEERAQRLAELQEQLKAVHEQLAALSQPQQNKPKKK 540

  Fly   161 -----------------------------PPSCTPTTECT--------PTPDWT-PPATLETSEQ 187
                                         ||..|.....:        |.|..| ||.|.|:.|:
  Rat   541 EKDKKEKKKEKHKKKEEMEENKKSKAKELPPKKTKKNNSSNSNVSKKEPAPTKTKPPPTYESEEE 605

  Fly   188 Q--EPFTTEEDLDLHAKIQQLDGEVLLHVIHFIQRME-GAEYCN-KELEFDICKLKVHTKRGIRD 248
            .  :|.:.||...|...|.:|.||.|..|:|.||..| ..:..| .|:|.|...||..|.|.:..
  Rat   606 DKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELER 670

  Fly   249 YLAS 252
            |:.|
  Rat   671 YVTS 674

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 42/100 (42%)
Brd4NP_001094373.1 Bromo_Brdt_I_like 58..164 CDD:99929
Bromo_Brdt_II_like 354..455 CDD:99930 42/100 (42%)
BET 610..674 CDD:293640 23/63 (37%)
BRD4_CDT 1361..1403 CDD:293710
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352465
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000322
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22880
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X197
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.