DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tbrd-3 and Brd4

Sequence 1:NP_726307.1 Gene:tbrd-3 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_008763392.1 Gene:Brd4 RGDID:1307282 Length:1429 Species:Rattus norvegicus

Alignment Length:332 Identity:93/333 (28%)
Similarity:139/333 (42%) Gaps:87/333 (26%)


  Fly     5 QETERSSPEINACKVIIKRLFSSTYKNIAWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLNT 69
            :::.:.|.::..|..|:|.:|:..:...||.||:|:|.:.||||||.:|::.|||:||::.:|.:
  Rat   372 EKSSKISEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLES 436

  Fly    70 GCYLSAADFAKDIRLIFYNTYLYTNPDHLCYHMAKQLQIIFEEMYSQV------QLYICSS---- 124
            ..|..|.:|..|:||:|.|.|.|..|||....||::||.:||..::::      .:...||    
  Rat   437 REYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPEEPVVTVSSPAVP 501

  Fly   125 -GSKVRAEEESSSDESDSSSPED------------------------------------------ 146
             .:||.|...||...|||||..|                                          
  Rat   502 PPTKVVAPPSSSDSSSDSSSDSDSSTDDSEEERAQRLAELQEQLKAVHEQLAALSQPQQNKPKKK 566

  Fly   147 ------------------EVNGSEVSPSIMGAPPSCTPTTECT--------PTPDWT-PPATLET 184
                              |.|....:..:   ||..|.....:        |.|..| ||.|.|:
  Rat   567 EKDKKEKKKEKHKKKEEMEENKKSKAKEL---PPKKTKKNNSSNSNVSKKEPAPTKTKPPPTYES 628

  Fly   185 SEQQ--EPFTTEEDLDLHAKIQQLDGEVLLHVIHFIQRME-GAEYCN-KELEFDICKLKVHTKRG 245
            .|:.  :|.:.||...|...|.:|.||.|..|:|.||..| ..:..| .|:|.|...||..|.|.
  Rat   629 EEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRE 693

  Fly   246 IRDYLAS 252
            :..|:.|
  Rat   694 LERYVTS 700

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 42/101 (42%)
Brd4XP_008763392.1 Bromo_Brdt_I_like 84..190 CDD:99929
Bromo_Brdt_II_like 380..481 CDD:99930 42/101 (42%)
BET 636..700 CDD:293640 23/64 (36%)
BRD4_CDT 1387..1429 CDD:293710
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C98917457
eggNOG 1 0.900 E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000242
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22880
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.