| Sequence 1: | NP_726307.1 | Gene: | tbrd-3 / 246604 | FlyBaseID: | FBgn0050417 | Length: | 268 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_002662470.2 | Gene: | brdt / 333996 | ZFINID: | ZDB-GENE-030131-5928 | Length: | 1093 | Species: | Danio rerio | 
| Alignment Length: | 325 | Identity: | 95/325 - (29%) | 
|---|---|---|---|
| Similarity: | 141/325 - (43%) | Gaps: | 72/325 - (22%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    11 SPEINACKVIIKRLFSSTYKNIAWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLNTGCYLSA 75 
  Fly    76 ADFAKDIRLIFYNTYLYTNPDHLCYHMAKQLQIIFEEMYSQV-----QLYICSSGSKV---RAEE 132 
  Fly   133 ESSSDESD--SSSPE-----DEVNGSEVSPSIMGAPPSCTPTTE----CTPTPDWTP-------- 178 
  Fly   179 ------------------PATL-------ETSEQQE-------------PFTTEEDLDLHAKIQQ 205 
  Fly   206 LDGEVLLHVIHFIQRMEG--AEYCNKELEFDICKLKVHTKRGIRDYLASKGFTGKRVART---KP 265 
  Fly   266  265 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| tbrd-3 | NP_726307.1 | Bromo_Brdt_II_like | 13..114 | CDD:99930 | 43/100 (43%) | 
| brdt | XP_002662470.2 | Bromo_Brdt_I_like | 29..135 | CDD:99929 | |
| Bromo_Brdt_II_like | 273..373 | CDD:99930 | 43/99 (43%) | ||
| BET | 514..577 | CDD:293640 | 19/62 (31%) | ||
| BRD4_CDT | 1050..1093 | CDD:293710 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C170594400 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0000322 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR22880 | 
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X197 | |
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 6 | 5.940 | |||||