DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-3 and brdt

DIOPT Version :9

Sequence 1:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_002662470.2 Gene:brdt / 333996 ZFINID:ZDB-GENE-030131-5928 Length:1093 Species:Danio rerio


Alignment Length:325 Identity:95/325 - (29%)
Similarity:141/325 - (43%) Gaps:72/325 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SPEINACKVIIKRLFSSTYKNIAWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLNTGCYLSA 75
            |..:..|..|:|.:||..:...||.||:|:|.:.|||.|||||:.:|||:||::.::....|..|
Zfish   270 SERLKYCNAILKEMFSKKHSAYAWPFYKPVDAETLGLLDYHEIIHQPMDMSTIKKKMEAREYTDA 334

  Fly    76 ADFAKDIRLIFYNTYLYTNPDHLCYHMAKQLQIIFEEMYSQV-----QLYICSSGSKV---RAEE 132
            ..||.|:||:|.|.|.|..|.|....||::||.:||..:|::     .....||.::|   ||..
Zfish   335 LQFAADMRLMFSNCYKYNPPGHEVVSMARKLQDVFEFRFSKIPDEPKNANPVSSHNRVKKERARS 399

  Fly   133 ESSSDESD--SSSPE-----DEVNGSEVSPSIMGAPPSCTPTTE----CTPTPDWTP-------- 178
            .|||:.||  |||||     :|.:..|.:..:...........|    .|.||...|        
Zfish   400 PSSSESSDSESSSPENSSDTEEEDEEERAHRLASLEEQLKAVREQLQLLTQTPLLKPKKKEKSKK 464

  Fly   179 ------------------PATL-------ETSEQQE-------------PFTTEEDLDLHAKIQQ 205
                              ||.:       ::|.::|             |.:.||...|...|.:
Zfish   465 KKKKERESSKRKGEEMKKPAKILKRSSSSKSSGRKESRACDSEEEMNTLPMSYEEKRQLSLDINK 529

  Fly   206 LDGEVLLHVIHFIQRMEG--AEYCNKELEFDICKLKVHTKRGIRDYLASKGFTGKRVART---KP 265
            |.|:.|..|::.|:..|.  .:...:|:|.|...||..|.|.:..|:.  |...|:...|   ||
Zfish   530 LPGDKLGKVVNIIKAREPLLRDTDPEEIEIDFETLKPSTLRALECYVV--GCLRKKTKETNKNKP 592

  Fly   266  265
            Zfish   593  592

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 43/100 (43%)
brdtXP_002662470.2 Bromo_Brdt_I_like 29..135 CDD:99929
Bromo_Brdt_II_like 273..373 CDD:99930 43/99 (43%)
BET 514..577 CDD:293640 19/62 (31%)
BRD4_CDT 1050..1093 CDD:293710
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594400
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000322
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22880
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X197
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.