DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tbrd-3 and EP300

Sequence 1:NP_726307.1 Gene:tbrd-3 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001420.2 Gene:EP300 HGNCID:3373 Length:2414 Species:Homo sapiens

Alignment Length:263 Identity:67/264 (25%)
Similarity:102/264 (39%) Gaps:74/264 (28%)


  Fly    36 FYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLNTGCYLSAADFAKDIRLIFYNTYLYTNPDHLCY 100
            |.:|:||||||:.||.:||:.||||||::.:|:||.|.....:..||.|:|.|.:||.......|
Human  1075 FRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVY 1139

  Fly   101 HMAKQLQIIFEEMYSQVQL---YICSSGSKVRAEEESSSDESDSSSPED---------------- 146
            ....:|..:||:....|..   |.|....:...:......:...:.|.|                
Human  1140 KYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFCEKC 1204

  Fly   147 --EVNGSEVSPSIMGAPPSCTPTTECTPTPDWTPPATLETSEQQEPFTTEEDLDLHAKIQQLDGE 209
              |:.|..||   :|..||             .|..|:    .:|.|:..       |...||.|
Human  1205 FNEIQGESVS---LGDDPS-------------QPQTTI----NKEQFSKR-------KNDTLDPE 1242

  Fly   210 VLLHVIHFIQRMEGAEYCNKELEFDICKLKVH-------------TKRGIRDYLASKGFTGKRVA 261
            :      |::..|    |.:::. .||.|. |             .|:..|....:| |:.||:.
Human  1243 L------FVECTE----CGRKMH-QICVLH-HEIIWPAGFVCDGCLKKSARTRKENK-FSAKRLP 1294

  Fly   262 RTK 264
            .|:
Human  1295 STR 1297

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 33/78 (42%)
EP300NP_001420.2 Interaction with RORA. {ECO:0000269|PubMed:9862959} 2..149
Interaction with ALX1. {ECO:0000269|PubMed:12929931} 2..139
Nuclear localization signal. {ECO:0000255} 11..17
Forkhead_N 124..258 CDD:254796
zf-TAZ 347..414 CDD:280324
KIX 566..646 CDD:280354
CRD1, mediates transcriptional repression 1017..1029
Bromo_cbp_like 1051..1158 CDD:99927 34/83 (41%)
RING_CBP-p300 1170..1242 CDD:276805 16/99 (16%)
PHD_p300 1243..1277 CDD:277116 7/46 (15%)
HAT_KAT11 1306..1612 CDD:285432
Interaction with histone. {ECO:0000269|PubMed:18273021} 1397..1399
Acetyl-CoA binding. {ECO:0000269|PubMed:24819397} 1398..1400
Acetyl-CoA binding. {ECO:0000269|PubMed:24819397} 1410..1411
Binding region for E1A adenovirus 1572..1818
ZZ_CBP 1668..1708 CDD:239077
ZnF_TAZ 1729..1807 CDD:214717
Med15 1937..>2412 CDD:255446
Interaction with HTLV-1 Tax 2003..2212
Creb_binding 2005..2095 CDD:286163
Interaction with NCOA2. {ECO:0000269|PubMed:15731352} 2041..2240
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.