DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tbrd-3 and Brd2

Sequence 1:NP_726307.1 Gene:tbrd-3 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_017172734.1 Gene:Brd2 MGIID:99495 Length:864 Species:Mus musculus

Alignment Length:372 Identity:98/373 (26%)
Similarity:141/373 (38%) Gaps:123/373 (33%)


  Fly    11 SPEINACKVIIKRLFSSTYKNIAWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLNTGCYLSA 75
            |.::..|..|:|.|.|..:...||.||:|:|...|||||||:|::.|||||||:.::....|..|
Mouse   346 SEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDA 410

  Fly    76 ADFAKDIRLIFYNTYLYTNPDHLCYHMAKQLQIIFEEMYSQ----------------VQLYICSS 124
            .:||.|:||:|.|.|.|..|||....||::||.:||..|::                :...:..|
Mouse   411 QEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPDEPLEPGPLPVSTALPPGLTKS 475

  Fly   125 GSKVRAEE---ESSSDESDSSSPEDEVNGSEVSPS-----------------------IMGAPPS 163
            .|:..:||   ||||:|.:....:::...||.|.|                       .:...|.
Mouse   476 SSESSSEESSSESSSEEEEEEEEDEDEEESESSDSEEERAHRLAELQEQLRAVHEQLAALSQGPI 540

  Fly   164 CTP----------------------------------------------------TTECTP---- 172
            ..|                                                    ||...|    
Mouse   541 SKPKRKREKKEKKKKRKAEKHRGRIGIDEDDKGPRAPRPPQPKKSKKAGGGGSNATTLSHPGFGT 605

  Fly   173 ----------TPDWTPPATLET---SEQQE---PFTTEEDLDLHAKIQQLDGEVLLHVIHFIQRM 221
                      ....|.|..|.|   ||::|   |.:.:|...|...|.:|.||.|..|:|.||..
Mouse   606 SGGSSNKLPKKSQKTAPPVLPTGYDSEEEEESRPMSYDEKRQLSLDINKLPGEKLGRVVHIIQAR 670

  Fly   222 EGA--EYCNKELEFDICKLKVHTKRGIRDYLASKGFTGKRVARTKPK 266
            |.:  :...:|:|.|...||..|.|.:..|:.|       ..|.||:
Mouse   671 EPSLRDSNPEEIEIDFETLKPSTLRELERYVLS-------CLRKKPR 710

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 46/101 (46%)
Brd2XP_017172734.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000242
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126719
Panther 1 1.100 O PTHR22880
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.