DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tbrd-3 and LOC108348112

Sequence 1:NP_726307.1 Gene:tbrd-3 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_017443518.1 Gene:LOC108348112 RGDID:11509343 Length:798 Species:Rattus norvegicus

Alignment Length:378 Identity:104/379 (27%)
Similarity:145/379 (38%) Gaps:124/379 (33%)


  Fly    11 SPEINACKVIIKRLFSSTYKNIAWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLNTGCYLSA 75
            |.::..|..|:|.|.|..:...||.||:|:|...|||||||:|::.|||||||:.::....|..|
  Rat   346 SEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDA 410

  Fly    76 ADFAKDIRLIFYNTYLYTNPDHLCYHMAKQLQIIFEEMYSQ----------------VQLYICSS 124
            .:||.|:||:|.|.|.|..|||....||::||.:||..|::                :...:..|
  Rat   411 QEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPDEPLEPGPLPVSTALPPGLAKS 475

  Fly   125 GSKVRAEE---ESSSDESDSSSPEDEVNGSEVSPS-----------------------IMGAPPS 163
            .|:..:||   ||||:|.:....|||...||.|.|                       .:...|.
  Rat   476 SSESSSEESSSESSSEEEEEEDEEDEEEESESSDSEEERAHRLAELQEQLRAVHEQLAALSQGPI 540

  Fly   164 CTP----------------------------------------------------TTECTP---- 172
            ..|                                                    ||...|    
  Rat   541 SKPKRKREKKEKKKKRKAEKHRGRIGIDEDDKGPRAPRPLQPKKSKKAGGGGSNATTLSHPGFGT 605

  Fly   173 ----------TPDWTPPATLET---SEQQE---PFTTEEDLDLHAKIQQLDGEVLLHVIHFIQRM 221
                      ....|.|..|.|   ||::|   |.:.:|...|...|.:|.||.|..|:|.||..
  Rat   606 SAGSSNKLPKKAQKTAPPVLPTGYDSEEEEESRPMSYDEKRQLSLDINKLPGEKLGRVVHIIQAR 670

  Fly   222 EGA--EYCNKELEFDICKLKVHTKRGIRDYLAS-------KGFT-GKRVARTK 264
            |.:  :...:|:|.|...||..|.|.:..|:.|       |.:| .|.|.:||
  Rat   671 EPSLRDSNPEEIEIDFETLKPSTLRELERYVLSCLRKKPRKPYTIRKPVGKTK 723

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 46/101 (46%)
LOC108348112XP_017443518.1 Bromo_Brdt_I_like 73..179 CDD:99929
Bromo_Brdt_II_like 348..449 CDD:99930 46/101 (46%)
BET 639..703 CDD:293640 21/64 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000242
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.