DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tbrd-3 and baz2a

Sequence 1:NP_726307.1 Gene:tbrd-3 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_002934572.1 Gene:baz2a XenbaseID:XB-GENE-965900 Length:1695 Species:Xenopus tropicalis

Alignment Length:93 Identity:35/94 (37%)
Similarity:54/94 (57%) Gaps:5/94 (5%)


  Fly     4 KQETERSSPEINACKVIIKRLFSSTYKNIAWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLN 68
            :..|...||::..|::|:..|.|   ...||.|.||::|:|  :..|.:|::.|||.||:||:|.
 Frog  1578 RMATRSHSPDLTFCEIILMELES---HEDAWPFLEPVNPRL--VPGYRKIIKNPMDFSTIRHKLL 1637

  Fly    69 TGCYLSAADFAKDIRLIFYNTYLYTNPD 96
            .|.|.|..:||:|..|:|.|..|:...|
 Frog  1638 NGKYSSCEEFAEDAELVFSNCQLFNEDD 1665

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 32/85 (38%)
baz2aXP_002934572.1 HAT_MBD 424..496 CDD:238691
DDT 699..757 CDD:280886
WHIM3 1236..1274 CDD:292248
PHD_BAZ2A 1475..1521 CDD:277099
Bromo_BAZ2A_B_like 1587..1683 CDD:99935 32/85 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C99300602
eggNOG 1 0.900 E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.