DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30393 and CG31910

Sequence 1:NP_726044.1 Gene:CG30393 FlyBaseID:FBgn0050393 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_723211.1 Gene:CG31910 FlyBaseID:FBgn0051910 Length:262 Species:Drosophila melanogaster

Alignment Length:206 Identity:65/207 (31%)
Similarity:111/207 (54%) Gaps:17/207 (8%)


  Fly    39 GLESSVTKILVAIEEMFCSYFEDLKKELELQKMAALTLNQLTQRYRINTKVDTSCTCPQIYEIES 103
            |:|:.|..:||.:|..:..|:...|.|::.||:....:..|||||.|....:.||..|::|.:.:
  Fly    44 GIEAEVLGLLVKLEMRYKEYYNLYKCEMKAQKILVERIWLLTQRYLILISSEQSCRYPEVYTLST 108

  Fly   104 DDAIINKYYIYYQVIACSNNNQGWVIHNMRPYVLLFRREC-------AKLNLNEDSPFIMGDAFH 161
            ::||||:|....:|:..|||       .|:..:|...::|       .:|:..:::||||||:.|
  Fly   109 EEAIINEYEEKLEVLRASNN-------KMKNTLLEINQQCKEFYAAYERLDKAQETPFIMGDSHH 166

  Fly   162 KPIKFFIDLVEELFAYFYSGHVQFDCAAHMLDPLDLNSIEYYQKLLEPN---EDFANYFKYNMSF 223
            :.||:...:..::|.|.|:..::..|..|.|||::|.|:|.|:.||:..   |:|..|......:
  Fly   167 RSIKYHKIMAVDIFNYLYATVLKLKCFMHQLDPVNLESVEEYRDLLQNESAMEEFEEYLNNQFVY 231

  Fly   224 CKCLRMPRRCP 234
            |||:.....||
  Fly   232 CKCIYPIPTCP 242



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134678252
eggNOG 1 0.900 E1_2FB6M
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.