| Sequence 1: | NP_726044.1 | Gene: | CG30393 / 246588 | FlyBaseID: | FBgn0050393 | Length: | 354 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_723211.1 | Gene: | CG31910 / 319021 | FlyBaseID: | FBgn0051910 | Length: | 262 | Species: | Drosophila melanogaster |
| Alignment Length: | 206 | Identity: | 65/206 - (31%) |
|---|---|---|---|
| Similarity: | 111/206 - (53%) | Gaps: | 17/206 - (8%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 39 GLESSVTKILVAIEEMFCSYFEDLKKELELQKMAALTLNQLTQRYRINTKVDTSCTCPQIYEIES 103
Fly 104 DDAIINKYYIYYQVIACSNNNQGWVIHNMRPYVLLFRREC-------AKLNLNEDSPFIMGDAFH 161
Fly 162 KPIKFFIDLVEELFAYFYSGHVQFDCAAHMLDPLDLNSIEYYQKLLEPN---EDFANYFKYNMSF 223
Fly 224 CKCLRMPRRCP 234 |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45471565 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_2FB6M | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0014254 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.830 | |||||