DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30393 and CG31910

DIOPT Version :9

Sequence 1:NP_726044.1 Gene:CG30393 / 246588 FlyBaseID:FBgn0050393 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_723211.1 Gene:CG31910 / 319021 FlyBaseID:FBgn0051910 Length:262 Species:Drosophila melanogaster


Alignment Length:206 Identity:65/206 - (31%)
Similarity:111/206 - (53%) Gaps:17/206 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 GLESSVTKILVAIEEMFCSYFEDLKKELELQKMAALTLNQLTQRYRINTKVDTSCTCPQIYEIES 103
            |:|:.|..:||.:|..:..|:...|.|::.||:....:..|||||.|....:.||..|::|.:.:
  Fly    44 GIEAEVLGLLVKLEMRYKEYYNLYKCEMKAQKILVERIWLLTQRYLILISSEQSCRYPEVYTLST 108

  Fly   104 DDAIINKYYIYYQVIACSNNNQGWVIHNMRPYVLLFRREC-------AKLNLNEDSPFIMGDAFH 161
            ::||||:|....:|:..|||       .|:..:|...::|       .:|:..:::||||||:.|
  Fly   109 EEAIINEYEEKLEVLRASNN-------KMKNTLLEINQQCKEFYAAYERLDKAQETPFIMGDSHH 166

  Fly   162 KPIKFFIDLVEELFAYFYSGHVQFDCAAHMLDPLDLNSIEYYQKLLEPN---EDFANYFKYNMSF 223
            :.||:...:..::|.|.|:..::..|..|.|||::|.|:|.|:.||:..   |:|..|......:
  Fly   167 RSIKYHKIMAVDIFNYLYATVLKLKCFMHQLDPVNLESVEEYRDLLQNESAMEEFEEYLNNQFVY 231

  Fly   224 CKCLRMPRRCP 234
            |||:.....||
  Fly   232 CKCIYPIPTCP 242



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471565
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FB6M
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014254
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.