DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30392 and Plekha3

DIOPT Version :9

Sequence 1:NP_001286672.1 Gene:CG30392 / 246587 FlyBaseID:FBgn0050392 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_112546.1 Gene:Plekha3 / 83435 MGIID:1932515 Length:297 Species:Mus musculus


Alignment Length:156 Identity:32/156 - (20%)
Similarity:58/156 - (37%) Gaps:33/156 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 AKDAEEQEHFNTFRT-MLDYEKEAQLLTQKGYVSGSRTLLRLHRGLDFVYEFLNRIQAIPDDQKT 144
            ||:.|..|...:.:| |.:......||.|:.:.               :.||::|.:..|  ..:
Mouse   101 AKEKEISETSESLKTKMSELRLYCDLLMQQVHT---------------IQEFVHRDERHP--SPS 148

  Fly   145 VDVCKEAYDDTLGKHHSFL--IRKGARLA-------MYAMPTRGDLLKKVC-SDVEAAKENL--P 197
            |:...||........::|:  :.:..::|       |:.:|....|:..|. |.|:..|.:.  |
Mouse   149 VENMNEASSLLSATCNTFITTLEECVKIANAKFKPEMFQLPHPDPLVSPVSPSPVQMMKRSASHP 213

  Fly   198 SMLKHMRTNYDRTEDLYTLYDLHSLP 223
            ......|::....|....   ||.||
Mouse   214 GSCSSERSSCSIKEPASA---LHRLP 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30392NP_001286672.1 GLTP 42..186 CDD:285880 21/114 (18%)
Plekha3NP_112546.1 PH_FAPP1_FAPP2 1..100 CDD:269951
Interaction with SACM1L. /evidence=ECO:0000250|UniProtKB:Q9HB20 1..100
Interaction with VAPA and VAPB. /evidence=ECO:0000250|UniProtKB:Q9HB20 97..297 32/156 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..297 11/42 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.