DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30392 and osbpl9

DIOPT Version :9

Sequence 1:NP_001286672.1 Gene:CG30392 / 246587 FlyBaseID:FBgn0050392 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001071273.1 Gene:osbpl9 / 777767 ZFINID:ZDB-GENE-061110-103 Length:733 Species:Danio rerio


Alignment Length:82 Identity:18/82 - (21%)
Similarity:29/82 - (35%) Gaps:21/82 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 FETSLLDEDD--VQLDAYLAAYEEIMKFFQLMGSVFSFVSSDVRSKID----------------- 74
            |..|:.|.|.  .:.||||....:.:|.|.  ..:......:.|.||:                 
Zfish   111 FVPSVQDFDKKLAEADAYLQILIDQLKLFD--EKIKDCKEDESRRKIENLKDTTCNMVESIKHCI 173

  Fly    75 ILYALRAKDAEEQEHFN 91
            :|..:....:.||:|.|
Zfish   174 VLLQIAKDQSNEQQHAN 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30392NP_001286672.1 GLTP 42..186 CDD:285880 14/67 (21%)
osbpl9NP_001071273.1 PH 4..98 CDD:278594
PH_ORP9 5..106 CDD:241444
PHA02664 <272..370 CDD:177447
Oxysterol_BP 377..725 CDD:279564
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.