DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30392 and Cert1

DIOPT Version :9

Sequence 1:NP_001286672.1 Gene:CG30392 / 246587 FlyBaseID:FBgn0050392 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_075909.1 Gene:Cert1 / 68018 MGIID:1915268 Length:624 Species:Mus musculus


Alignment Length:211 Identity:43/211 - (20%)
Similarity:74/211 - (35%) Gaps:69/211 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LDEDDVQLDAYLAAY-------EEIMKFFQLMGSVFSFVSSDVRSKIDILYALRAKDAEEQ-EHF 90
            ::|:.:.||...|.:       .|:..:|.         :.|||:           |.|.. |:|
Mouse   434 VEENGIVLDPLKATHAVKGVTGHEVCNYFW---------NVDVRN-----------DWETTIENF 478

  Fly    91 NTFRTMLDYEKEAQLLTQKGYVSGSRTLLRLHRGLDFVYEFLNRIQAIP----DDQKTVDVCKEA 151
            :...|:.|.........::.:.:..|.:|           :|:.|:.||    :|.:|..||..:
Mouse   479 HVVETLADNAIIVYQTHKRVWPASQRDVL-----------YLSAIRKIPALTENDPETWIVCNFS 532

  Fly   152 YDDTLGKHHSFLIRKGARLAMYAM----PTRGD-------LLKKV-------------CSDVEA- 191
            .|......::..:|....:||...    |..||       :|.|:             .|.:.| 
Mouse   533 VDHDSAPLNNRCVRAKINIAMICQTLVSPPEGDQEISRDNILCKITYVANVNPGGWAPASVLRAV 597

  Fly   192 AKENLPSMLKHMRTNY 207
            ||...|..||.. |:|
Mouse   598 AKREYPKFLKRF-TSY 612

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30392NP_001286672.1 GLTP 42..186 CDD:285880 32/179 (18%)
Cert1NP_075909.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
PH_GPBP 26..125 CDD:270100
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..221
FFAT. /evidence=ECO:0000250|UniProtKB:Q9Y5P4 321..327
START_STARD11-like 391..624 CDD:176881 43/211 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.