DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30392 and GLTP

DIOPT Version :10

Sequence 1:NP_611572.2 Gene:CG30392 / 246587 FlyBaseID:FBgn0050392 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_057517.1 Gene:GLTP / 51228 HGNCID:24867 Length:209 Species:Homo sapiens


Alignment Length:198 Identity:52/198 - (26%)
Similarity:91/198 - (45%) Gaps:30/198 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 EDDVQLDAYLAAYEEIMKFFQLMGS-VFSFVSSDVRSKIDILYALRAKDAEEQEHFNTFRTMLDY 99
            :..::...:|.|...:..||..:|| ||:.:.:|:...|..:.|:...:..:   |.|.:.:|:.
Human    15 DKQIETGPFLEAVSHLPPFFDCLGSPVFTPIKADISGNITKIKAVYDTNPAK---FRTLQNILEV 76

  Fly   100 EKEAQLLTQKGY------VSGSRTLLRLHRGLDFVYEFLNRIQAIPDDQK--------TVDVCKE 150
            |||.       |      |..:..|:.|.|||.|:..||   |:|.|.::        .|:..| 
Human    77 EKEM-------YGAEWPKVGATLALMWLKRGLRFIQVFL---QSICDGERDENHPNLIRVNATK- 130

  Fly   151 AYDDTLGKHHSFLIRKGARLAMYAMPTRGDLLKKVCSDVEAAKENLPSMLKHMRTNYDRTED-LY 214
            ||:..|.|:|.::::|..:.|:||.|.:.|.||.:.......:|.....::....||..|.| :|
Human   131 AYEMALKKYHGWIVQKIFQAALYAAPYKSDFLKALSKGQNVTEEECLEKIRLFLVNYTATIDVIY 195

  Fly   215 TLY 217
            .:|
Human   196 EMY 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30392NP_611572.2 GLTP 39..183 CDD:462575 43/158 (27%)
GLTPNP_057517.1 GLTP 18..163 CDD:462575 43/158 (27%)
2 X 12 AA approximate tandem repeats 45..66 3/20 (15%)

Return to query results.
Submit another query.