DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30392 and Osbpl9

DIOPT Version :9

Sequence 1:NP_001286672.1 Gene:CG30392 / 246587 FlyBaseID:FBgn0050392 Length:223 Species:Drosophila melanogaster
Sequence 2:XP_038965486.1 Gene:Osbpl9 / 298369 RGDID:1311508 Length:883 Species:Rattus norvegicus


Alignment Length:140 Identity:32/140 - (22%)
Similarity:57/140 - (40%) Gaps:22/140 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKTSLATQTNGTAENGNCFDILKVSNLFETSLLDEDD--VQLDAYLAAYEEIMKFFQLMGSVFS 63
            :|.|....|::|.:.......|:.:.:.|..|:.|.|.  .:.||||....|.:|.|.  ..:.:
  Rat   231 ISTTLAFFQSSGISPVLEFSKIIGLDSGFVPSVQDFDKKLTEADAYLQILIEQLKLFD--DKLQN 293

  Fly    64 FVSSDVRSKIDILYALRAKDAEEQEHFNTFRTMLDYEKEAQLLTQKGYVSGSRTLLRLHRGLDFV 128
            ....:.|.|::.|     ||        |..:|::..|...:|.|   ::..::....|  .|.|
  Rat   294 CKDDEQRKKVETL-----KD--------TTNSMVESIKHCIVLLQ---IAKDQSNAEQH--ADGV 340

  Fly   129 YEFLNRIQAI 138
            ...:|.:.||
  Rat   341 LSTINPVDAI 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30392NP_001286672.1 GLTP 42..186 CDD:285880 23/97 (24%)
Osbpl9XP_038965486.1 PH-like <205..230 CDD:418428
Oxysterol_BP 524..870 CDD:395990
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.