DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30392 and Plekha3

DIOPT Version :9

Sequence 1:NP_001286672.1 Gene:CG30392 / 246587 FlyBaseID:FBgn0050392 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001013095.1 Gene:Plekha3 / 295674 RGDID:1305244 Length:299 Species:Rattus norvegicus


Alignment Length:134 Identity:29/134 - (21%)
Similarity:47/134 - (35%) Gaps:43/134 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 FVYEFLNRIQAIPDDQKTVDVCK---------------EAYDDTL------GKHHSFLIRKGARL 170
            ||.:  |.|.:..|.|.  ||||               .:.|:|.      |:.|.::....|..
  Rat    20 FVLD--NGILSYYDSQD--DVCKGSKGSIKMAVCEIKVHSADNTRMELIIPGEQHFYMKAVNAAE 80

  Fly   171 AMYAMPTRGDLLKKVC-SDVEAAK--------ENLPSMLKHMRTNYD-RTEDLYTLYDL------ 219
            ....:...|.  .|.| :|...||        |:|.:.:..:|...| ..:.::|:.:.      
  Rat    81 RQRWLVALGS--SKACLTDTRTAKEKEISETSESLKTKMSELRLYCDLLMQQVHTIQEFVHHDED 143

  Fly   220 HSLP 223
            ||.|
  Rat   144 HSSP 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30392NP_001286672.1 GLTP 42..186 CDD:285880 17/79 (22%)
Plekha3NP_001013095.1 PH_FAPP1_FAPP2 1..100 CDD:269951 19/85 (22%)
PH 1..93 CDD:278594 16/78 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.